Ввг или nym что лучше: ВВГ vs. NYM — Блоги Mastergrad

Содержание

Что выбрать — ПВС, ВВГ или NYM

Часто в описании проводящих элементов можно на одной и той же модификации встречать определение кабеля или провода. Даже некоторые консультанты в магазинах не могут дать точного ответа на вопросы. На самом деле точного определения не существует. Одним специалисты считают, что всё, что может монтироваться открыто или в качестве воздушной линии — это провода. Другие специалисты делают разделение исключительно по толщине или количеству жил. Сейчас имеется большое количество различных типов этих изделий. Всё чаще приходится видеть аббревиатуры ПВС, ВВГ и NYM. Необходимо разобраться с каждым типом для того, чтобы можно было затем делать окончательный выбор между ними.

Провода типа ПВС

В большинстве различных справочников он фигурирует только в качестве соединительного изделия. Жилы относятся к малым и средним сечениям. Срединный проводник плотно изолирован при помощи поливинилхлорида, а также имеется общая особо прочная оболочка из ПВХ. Минимальный срок эксплуатации, устанавливаемый производителями, составляет 10 лет, хотя на практике он будет служить намного дольше. Это изделие характеризуется высокой устойчивостью к перепадам температур, что очень важно для сурового российского климата. Базовое преимущество провода ПВС состоит в его пожарной безопасности. Он не горит, а только немного оплавляется. Именно эта модификация устанавливается во всей бытовой технике, а также в электроинструменте. Провод ПВС может быть изготовлен для использования в электросетях 380В 50Гц. Он используется для создания внутренних систем проводки в жилых и офисных помещениях. Многожильные концы проводов требуют лужения перед зажимом. Желательно применять уплотнительную скрутку с дальнейшим лужением. 

Провода типа ВВГ

В отличие от предыдущего варианта его жилы являются цельными по всей длине. Это даёт гораздо большую жёсткость, что обеспечивает качественное прокладывание в стенах. По сути, это провод, являющийся кабелем.

Иногда электрики называют его маленькой копией кабелей. Обычно каждая жила имеет свою собственную ПВХ оплётку, в то время как сверху находится общая оболочка, обеспечивающая жесткую фиксацию и надежную защиту от внешнего воздействия. Иногда допускается незначительный гибкий экран, существенно снижающий воздействие магнитного поля. Цельнометаллический стержень не обгорает. Он будет лежать в стене практически вечно, ведь срок использования поливинилхлорида неограничен. Перед тем, как выбрать провод ВВГ, проконсультируйтесь с профильными специалистами. Обычно граничная температура эксплуатации составляет от -50 до +50 градусов по Цельсию. При большой толщине жилы из-за отсутствия промежуточного наполнителя поверхность изделия выглядит ребристой, с неодинаковой формой по всей протяженности. Особенно это касается толстых кабелей. Многожильные решения поддерживаются только для кабелей под высокое напряжение.

Провода типа NYM

Кабель NYM является наиболее распространенным европейским решением. Аббревиатура произошла от сложной немецкой классификации. Основное отличие этого провода от ВВГ заключается в наличии специального наполнителя, содержащего в себе все жилы. Каждая из них находится в оплётке из ПВХ, есть также общая круглая оболочка. Наполнитель изготовлен из пористого материала, препятствующего проникновению влаги. Он не подвержен воспламенению даже при коротком замыкании. Купить провод NYM можно для прокладывания в кабельных шахтах под землей. Они совершенно невосприимчивы даже к полному погружению на небольшую глубину. 

Какой из этих проводов выбрать

Провода NYM являются образцом немецкой рациональности, но они плохо сопрягаются с другими типами. Поэтому ими нужно оснащать всё здание с нуля. Провода ВВГ и ПВС — это отечественные надежные решения, которые нет смысла сравнивать между собой, ведь они полностью идентичны. Единственное отличие в механической подвижности. Главное — смотреть на сечение, а также подбирать его на базе инженерных расчётов. Только так можно добиться правильной совместимости всех элементов.

Чем отличается кабель ВВГнг от кабеля NYM-J?

В настоящее время монтаж электрической низковольтной распределительной сети выполняется проводами ВВГнг или NYM-J. Эти кабельно-проводниковые изделия имеют много общего:

— медные токопроводящие жилы;
— защитная поливинилхлоридная оболочка;
— предназначаются для фиксированного монтажа.


Отличия

Но, между этими разновидностями кабелями существует и достаточно много различий:

1. Номинальное рабочее напряжение кабеля NYM-J составляет до 660В, в то время, как для кабелей ВВГнг эта величина составляет 660В или 1000В.

2. Сечение токопроводящих жил у кабелей марки NYM-J лежит в диапазоне 1,5мм2 – 35мм2. Для кабеля марки ВВГнг эта величина составляет 1,5 мм2 – 1000мм2 (одножильные кабели) и 1,5 мм2 – 240мм2 для многожильных.

3. В отношении пожарной безопасности, кабель NYM-J обеспечивает отсутствие распространения огня при одиночной прокладке, в это же время кабель ВВГнг не распространяет горение только при групповом монтаже. По этой причине для монтажа во взрыво- и пожароопасных зонах используют кабель марки ВВГнг-FRLS.

4. В отличие от NYM-J, кабель марки ВВГнг не имеет заполнения пустот между скрученными жилами в защитной оболочке.

5. Температура эксплуатации кабеля NYM-J составляет от -300С до +400С, тогда как, кабель марки ВВГнг допускает эксплуатацию в диапазоне от -500С до +500С.

6. Срок эксплуатации в соответствии с нормативно-технической документацией для NYM-J составляет 40 лет, а для ВВГнг – 30 лет.

Сфера использования

В каждом индивидуальном случае следует оценивать различные технико-экономические факторы кабельной продукции, чтобы определить оптимальный вариант.

Для монтажа в жилых и общественных объектах чаще используют кабель NYM-J, а для производственных и офисных объектов больше адаптирован ВВГнг. При необходимости обеспечить монтаж электрической сети в пожароопасных зонах используют силовой кабель ВВГнг-FRLS. Он отвечает самым современным требованиям пожарной безопасности и имеет высокую устойчивость к возгоранию.


Какой кабель лучше использовать для электропроводки в квартире

Большой квартирный ремонт обязательно включает замену электропроводки. Есть две главные причины для этого действа.

Первая — возраст этой самой проводки. Как правило, капитальные или любые серьёзные ремонты проводят лет так через 15-20 после сдачи квартиры. За это время, даже правильно сделанная, домашняя электросеть стареет и изнашивается. А значит, потенциально становится источником опасности для обитателей жилья.

Вторая причина — перепланировка и большой ремонт отдельных помещений с добавлением новых электроприборов. Врезки и прочие соединения новой проводки со старой крайне нежелательны. Из-за несовпадения характеристик кабеля или материалов в нём.

Так что, вопрос — менять ли электропроводку, считается решённым, остаётся разобраться с его практическим воплощением. И начать нужно с выбора кабеля.

Кабель для электропроводки в квартире — 300 марок и 5000 разновидностей

С какого боку тут начинать? Схватится за голову человек, далёкий от электромонтажа. И есть с чего хвататься. Потому что кабелей и проводов не просто много, их буквально не сосчитать, как Донов Педро в Бразилии. Даже профессиональные электрики иногда «тонут» и путаются в изобилии производителей и продукции.

Выбор же провода для электропроводки в квартире, это вопрос не только стоимости ремонта. Куда важнее момент, что проводка должна обеспечивать «доставку» электричества в любой уголок квартиры и быть безопасной, то есть не «кусаться» током. А так же быть пожаростойкой и надёжной.

Внимание! Главное в надёжной элекропроводке  — найти правильного электрика. Заниматься электрикой и выбирать кабель для проводки в квартире должен специально обученный мастер! У которого есть допуск к электромонтажным работам и практический опыт.

Мы кратко расскажем про кабели и провода, их сечение, маркировку, материалы и виды.

Объясним, что подходит для домашней проводки, а что использовать нельзя. Чтобы вы были в курсе того, что ваш электрик делает и почему именно так.

Характеристики проводов и кабелей, на которые следует обратить внимание при выборе

Сразу оговорим, что речь идёт о бытовом силовом кабеле или проводе с вольтажом 220/380 В для передачи электротока в домашней сети. Все остальные виды вроде нагревательных, телевизионных, компьютерных и прочих сейчас мы не рассматриваем.

Общий список характеристик выглядит так:

  • материал жилы;
  • конструкция;
  • сечение;
  • толщина жильной изоляции;
  • толщина оболочки;
  • маркировка;
  • расцветка жил;
  • упаковка;
  • сертификат;
  • состояние продукции.

1. Материал и конструкция

По составу жилы, кабельная продукция делится на медную и алюминиевую. Изделия из меди более надёжные, сопротивление ниже, показатели тока выше, нагрев меньше, если сравнивать с алюминиевым равного сечения.

Кроме того, медь меньше окисляется, более пластичная, а значит, кабель служит дольше без потери свойств и характеристик.

Внимание! Делать проводку в квартире алюминиевый кабель запрещено согласно требованиями ПУЭ (правила устройства электроустановок).

По конструкции выпускаются одножильные (однопроволочные) и многожильные (многопроволочные) кабели и провода. Одножильные разновидности более жёсткие и негибкие, особенно с большим сечением проводника.

Отвечая на вопрос, «какой провод использовать для проводки под штукатурку», можно сказать, что теоретически подойдёт и одножильный однопроволочный медный кабель. Штукатурка создаст дополнительную защиту для такого проводника. Но фактически, никто не прокладывает домашнюю электросеть однопроволочным проводом.

Многопроволочный одножильный  кабель мягче и пластичнее. Он хорошо переносит перегибы, повороты и годится как для открытой проводки, так и для скрытой под штукатурку. Именно трехжильный однопроволочный используют сейчас для прокладки в квартирах.

Внимание! Не путайте кабели, в которых каждая жила состоит из одного проводника, с проводами, где жила изготавливается из нескольких проводников. Многопроволочные кабельные изделия запрещены для стационарной прокладки в квартире из-за высокой пожароопасности. Подробнее о них в блоке «какие провода нельзя использовать для электропроводки в квартире»

2. Сечение кабеля для проводки в квартире

Измеряется в «квадратах», то бишь квадратных миллиметрах и показывает пропускную способность. У медного кабеля один «квадрат» пропускает 8-10 Ампер тока, у алюминиевого лишь 5 А. Для безопасной работы проводник следует подбирать с запасом пропускной способности, что обеспечивает нагрев провода в пределах допустимой величины или говоря проще, чтобы от нагрузки не «поплыла» изоляция. Кроме того, при скрытой проводке надо учитывать, что она слабее охлаждается, а значит, запас сечения должен это компенсировать.  

Внимание! Не путайте сечение кабеля с его диаметром, это две большие разницы! Диаметр можно измерить линейкой, а лучше штангенциркулем. А затем подставить его в формулу и посчитать площадь сечения.

Ещё запомните, что выбор кабеля для проводки в квартире всегда идёт с округлением в большую сторону. Если при расчёте получается 2.3 «квадрата», выбирается кабель два с половиной, а не два «квадрата».

В идеале, сечение должно совпадать с маркировкой на бирке кабеля, но фактически оно часто отличается в меньшую сторону. Небольшие расхождения допустимы, потому что кабель сертифицируется по сопротивлению, а не сечению жилы. Если расхождения существенны, это брак. Опытный электрик увидит его визуально, а вы можете измерить диаметр жилы и рассчитать сечение для интереса или помощи другу, который самостоятельно решит купить кабель для квартирной электропроводки.

Некоторые электрики советуют взять кабель с номиналом выше расчётного. Например, 4 «квадрата», вместо 2.5, чтобы покрыть «недостачу» сечения, если таковая окажется. Но, тогда придётся рассчитывать соответственно защиту проводки и ставить правильные автоматы и УЗО.

Совет! Мы рекомендуем на электропроводку в квартире сечение проводов из меди от 1.5 до 2.5 кв. мм. На розетки пускать два с половиной «квадрата» и полтора — на освещение.

3. Толщина жильной изоляции

Каждая жила в многожильном или одножильном кабеле имеет изоляцию из ПВХ пластиката обычного типа или с пониженной горючестью, также используются полимеры и сшитый полиэтилен. Толщину изоляции регулируют ГОСТы и она должна быть достаточной. Для бытовых кабелей (номинальное напряжение до 660В) сечением 1.5 и 2.5 мм2 толщина изоляционного слоя по нормативу — 0.6 мм. Допускается отклонение, но изоляция не должна быть тоньше 0.44 мм.

Проще говоря, есть промежуток толщин, куда должна «вписываться» изоляция, чтобы проводка служила надёжно и не было заморочек при монтаже. Нарушил ли производитель технологию — без микрометра не определишь, если не возишься с кабелями каждый день. Поэтому, если нет рядом опытного электрика — покупать нужно только в проверенных магазинах и кабели известных марок.

4. Толщина оболочки

Оболочка охватывает кабель поверх изолированных жил, фиксирует их и защищает. Сделана она, как и жильная изоляция, из ПВХ пластиката или полимера, но имеет большую толщину. Для многожильных кабелей толщина равна 1.8 мм, для одножильных — 1.4 мм. Так же возможны отклонения в меньшую сторону, но незначительные.

Изолирующая оболочка — обязательный элемент. Для любого кабеля квартирной проводки, даже с минимальной мощностью, «прописана» двойная изоляция. То есть сначала на жиле, а потом поверх неё. Это обеспечивает безопасность людей и предохраняет сам проводник от повреждений.

5. Маркировка

Это надпись на оболочке кабеля для монтажа электропроводки в квартире. Она содержит всю нужную информацию для выбора. Надпись пропечатывается или выдавливается при изготовлении кабельной продукции. Она должна быть чёткой, контрастной, хорошо читаемой.

В маркировке указывается:

  • Марка изделия (кабеля или провода), в которой зашифрованы основные свойства и характеристики.
  • Название завода-изготовителя.
  • Год выпуска.
  • Количество жил.
  • Сечение.
  • Номинал напряжения.

Надпись наносится по всей длине проводника с небольшими интервалами.

На ценнике и в каталогах интернет-магазинов обычно не указывают год выпуска и изготовителя и пишут маркировку в виде ВВГнг(ож)-0,66 кВ 3х1,5 или ВВГ, ВВГнг кабель 3х1,5.

Расшифровывается как трёхжильный медный кабель с сечением жилы 1.5 «квадрата» (3х1,5), однопроволочное исполнение жилы (ож). Изоляция и оболочка из ПВХ-пластиката (ВВ), кабель гибкий (Г), негорючий (нг). Номинальное напряжение 660 Вольт.

Запомните! Буквенное обозначение марки кабеля начинается с материала жилы, для алюминия ставится всегда буква А, для медибуква не указывается, поэтому все кабели марок ВВГ всех модификаций имеют медный проводник.

6. Расцветка жил

О расцветке нужно знать, что она или сплошная цветная, или нанесена полоса на оболочке вдоль всего кабеля шириной примерно в миллиметр. Это стандарт. Всё остальное, в виде размазни, пятен, полосочек поперёк — от лукавого. И говорит о том, что делали кабель в каком-то подвале непонятные люди.

По цветам жил есть таблица, которую знает любой опытный электрик. Там расписано, каким оттенком обозначаются основные жилы — фазные, нулевые, заземляющие. Сделано это для удобства при монтаже, чтобы видеть, куда какой проводник подсоединять. Фазные и рабочие проводники могут отличаться по расцветкам, «землю» же всегда «красят» в жёлто-зелёный цвет.

7. Упаковка

Стандартная для всех видов — это бухта или барабан. Бухты идут для продажи в магазины, на барабаны наматывают для оптовиков, строителей и прочих крупных закупщиков. В любом случае на кабель крепится бирка с описанием.

Содержимое бирки повторяет информацию надписи на оболочке с некоторыми дополнениями. В ней указывается:

  • наименование завода или товарный знак изготовителя
  • марка (обозначение) продукции
  • ГОСТ или ТУ
  • дата выпуска
  • число отрезков с их длиной
  • номер барабана
  • вес проводника
  • знак соответствия
  • отметка ОТК.

Если вы пришли купить кабель для проводки в квартире целой бухтой в 100 м, бирку вы получите вместе с ней. Но если вам отрезают кусок, то ярлык не отдадут, его можно просто посмотреть.

8. Сертификат

Нужен для подтверждения, что кабель качественный. Обычно продукция имеет 2 документа — сертификат соответствия, отвечающий за годность кабеля как электромонтажного материала и сертификат пожарной безопасности. Вы можете попросить их у продавца для ознакомления. Документы должны быть заполнены с указанием ГОСТов на кабель и иметь действующий срок, например, до конца текущего года. Как правило, в документации указываются ТУ (технические условия) по ГОСТ и для кабельной продукции это равносильно соответствию ГОСТу.

9. Состояние

Это внешний вид силового провода. Обращайте внимание, как выглядит кабель, потому что за помятостями, сильными перегибами, сдавленностью скрывается внутренний брак. Жилы могу оказаться переломанными и даже замкнутыми друг на друга. Понятно, что укладывать такой материал нельзя, поэтому, не поленитесь осмотреть кабель в магазине, ещё до оплаты при самостоятельной покупке.

Какой кабель нужен для проводки в квартире

Мы уже говорили, что электропроводка в квартире «требует» 2 сечения кабеля.

Для розеток нужно брать сечение 2.5 мм2, потому что включаемая нагрузка может доходить 3-4 киловатт. А кабель в два с половиной «квадрата» как раз и рассчитан на максимум мощности до 5,9 киловатта и ток до 27 Ампер. Это не значит, что нужно «нагружать» кабельную линию до упора. Выбор всегда идёт с запасом от планируемой нагрузки на треть. Тем более, что лежащий под штукатуркой кабель слабее охлаждается и это тоже учитывается при подборе.

Для контура освещения используют сечение 1,5 мм2.  Нагрузка тут значительно меньше, но даже если вы решите устроить иллюминацию в квартире, тока и запаса мощности хватит с избытком.

Важная информация! Поскольку, современные правила электробезопасности требуют заземлять домашние электроприборы и ставить специальные розетки, то для прокладки используется трёхжильный кабель. В котором, есть рабочий фазный проводник, нулевой рабочий и защитный ноль.

Какой кабель рекомендует интернет-магазин 220pro.ru для скрытой проводки в доме или квартире

Напомним, что маркировка содержит основные характеристики кабельной продукции. Буквенные обозначения указывают на материалы жил, изоляции, оболочки и гибкость, цифровые — на число проводящих жил и их сечение.

Кабель ВВГ

Самый распространённый отечественный кабель для электромонтажа в квартире. Имеет одножильные медные проводники, изоляцию и оболочку из ПВХ пластиката, используется в помещениях с нормальной и повышенной влажностью. Рассчитан на напряжение до 660 Вольт. Относится к гибким небронированным силовым проводам. Может включать от 1 до 5 жил, сечением от полутора до 240 «квадратов». Форма проводника круглая, плоская или треугольная.

Кабели ВВГ выпускаются в нескольких модификациях:

  • ВВГ — основной тип с виниловой изоляцией и оболочкой;
  • ВВГнг — негорючий силовой провод, изоляция жил самозатухающая, то есть горение не распространяется;
  • ВВГнг-LS  — так же имеет самозатухающую негорючую изоляцию жил (нг) и оболочку с низким дымовыделением;
  • ВВГнг FR-LS — в дополнение к негорючести и малой задымлённости, это вид кабеля получил дополнительную огнезащиту из слюдяной ленты.

Все марки с приставкой нг можно монтировать в пучках, то есть прокладывать в одной гофре, трубе или шурфе несколько кабельных линий.

Кабель для электропроводки в квартире советуем брать марок ВВГнг или ВВГнг-LS.

Обычный ВВГ дешевле, но не подходит для пучковой прокладки и оболочка менее огнестойкая и дымящая. А марка ВВГнг FR-LS относится к профессиональным и используется в условиях повышенной пожароопасности на предприятиях и стоит гораздо дороже.

Кабель NYM

Медный кабель европейского стандарта, разработанный в Германии. Производится на российских заводах и соответствует нормам ЕС и ГОСТам. По исполнению аналогичен кабелю ВВГнг, номинальное напряжение 660 В. Выпускается однопроволочный многожильный NYM-кабель с сечением 1.5-10 мм2 и многопроволочный с сечением от 16 мм2. Число жил 1-5, изоляция и оболочка из ПВХ, негорючесть обеспечивает наполнитель из резины между изоляцией жил и кабельной оболочкой.

Обратите внимание! В магазинах можно встретить дешёвые кабели с маркировкой NUM. Эта «опечатка» говорит, что перед вами копия с пониженными характеристиками. Покупая его, вы рискуете получить некачественную продукцию. Советуем воздержаться от сомнительной экономии на безопасности.

Кабели ВВГнг и NYM имеют схожие характеристики и преимущества использования:

  • Качественное исполнение. Жилы, изоляция, оболочка соответствуют ГОСТу и это делает кабель надёжным.
  • Удобный монтаж и лёгкая разделка. Круглый кабель удобен в монтаже из-за отсутствия перекруток, его проще уплотнять при вводе.
  • Высокая пожаростойкость и безопасность. Соблюдение стандартов обеспечивает безопасную работу кабеля под нагрузкой, а специальная изоляция позволяет прокладывать пучками, без опасности возгорания от взаимного нагрева.
  • Самозатухание и низкая задымлённость. Материал оболочки самозатухающий и замедляет горение. А так же обеспечивает слабое задымление без опасных галогенов. Если защита сработает с замедлением, то ущерб от возгорания будет минимальным.
  • Большой выбор вариантов в марках по цене под любой бюджет.

Какой провод не подходит для проводки в квартире

И ещё один важный момент. Мы понимаем, что для большинства «провод» и «кабель» это синонимы. На самом деле, это разные виды кабельной продукции. Основное различие, кабель всегда имеет очень прочную двухслойную изоляцию, с первым слоем поверх токопроводящих жил и вторым, закрывающим весь пучок. Даже если в кабеле одна жила, изоляция всегда двойная. Провод — более слабая конструкция с лёгкой изоляцией.

Обратите внимание! Делать проводку в квартире проводом, даже многожильным или многопроволочным —  очень плохая затея.

Главная беда проводов — их слабая стойкость к длительному нагреву при постоянной нагрузке и высокая возгораемость. Поэтому, они не соответствуют требованиям ПУЭ по проводке в жилых помещениях.

Провод ПВС

Это соединительный медный провод с виниловой изоляцией и оболочкой. Используется для подключения бытовой электротехники к домашней сети, для изготовления удлинительных шнуров. Количество проводников 2-6, конструкция жилы многопроволочная, сечение 0.75-10 мм2. Рассчитан на номинал напряжения в 380 В.

Внимание! Не нужно брать провод ПВС для проводки по совету друзей или из экономии.
  • Во-первых, ПВС имеют многопроволочную конструкцию жилы. А это значит, что все концы для соединения нужно лудить и обязательно паять. Это занимает много времени и требует высокого качеств обработки жил и большого опыта у электрика.
  • Во-вторых, многопроволочная конструкция жилы — это фактор повышенной пожароопасности. Такой провод греется сильнее, а значит, изоляция изнашивается быстрее, что опасно и может закончиться коротким замыканием.
  • В-третьих, провод ПВС нельзя прокладывать пучком, как кабель. Только с расстоянием между нитками. То есть, штробить стены под каждую линию отдельно.

Так что, экономия получается очень сомнительная и символическая. Низкая цена провода будет «съедена» высокой стоимостью монтажа. А качество проводки оставит желать лучшего.

Провод ШВВП и ПВВП

Монтажные шнуры или кабели с одно и многопроволочными медными жилами. Используются для подключения электрооборудования и бытовой техники. Имеют короткий срок эксплуатации, многожильный тип требует обрабатывать окончания и проводить пайку при монтаже. Для стационарной проводки не годятся из-за отсутствия негорючей изоляции и слабых характеристик.

Провод ПУНП

Внимание! ПУНП запрещён к использованию для проводки с 2007 года из-за своей ненадёжности.

Хотя находятся «умельцы» и среди клиентов, и среди горе-электриков, которые его пользуют. Мотивируя это тем, что «во всех старых квартирах стоит именно он».

Но «граждане» забывают, что со времён СССР очень сильно изменилась оснащённость домашним электрооборудованием и выросла его мощность. Поэтому ПУНП и запретили — он маломощный, со слабой изоляцией и не держит современных нагрузок.

Комплектующие и аксессуары для кабеля

При монтаже электропроводки требуется не только кабель, но и целый список оборудования, комплектующих, электроустановочных изделий и аксессуаров. Чтобы определиться с точным количеством, электрик всегда делает план или схему проводки. Но, мы сейчас говорим в общем, поэтому назовём примерный список дополнительных элементов.

Вам потребуются:

  • автоматы защиты и УЗО;
  • монтажные коробки и подрозетники;
  • розетки и выключатели;
  • гофра, кабель-каналы, крепления для них и электроустановочные изделия для кабель-каналов;
  • изоляция, хомуты, наконечники  и тд.

Естественно, всё подбирается под условия помещения, нагрузку и тип скрытой проводки. Ведь она может быть как в стене, так и в гипсокартонных конструкциях. Опытный электрик учтёт все тонкости и выдаст список или пойдёт закупать товар вместе с вами.

Подведём итоги

Интернет-магазин 220pro.ru предлагает только качественный кабель для электропроводки в квартире или доме. Полный список марок и типов в разделе: http://220pro.ru/catalog/kabel_provod/

Заходите и выбирайте ваш кабель!

А ещё задавайте любые вопросы. Смешные и наивные в первую очередь! Они самые правильные! Потому что, лучше смешить электриков, чем пожарников, согласитесь?

Мы всегда отвечаем на вопросы и рассказываем обо всех тонкостях монтажа. Быстро подбираем полный комплект для устройства квартирной проводки от кабеля до розеток и выключателей. Учитываем ваши пожелания и бюджет.

Звоните, спрашивайте! Телефоны

+7 (495) 540-49-82

 8 (800) 333-49-42

или задайте вопрос электрику онлайн.

Ваши дежурные электрики 220pro.ru

Какие провода и кабели лучше всего использовать в домашней электропроводке

В настоящее время для монтажа домашней электропроводки используются провода и кабели исключительно с медными жилами. Провода и кабели с алюминиевыми жилами для внутренней электропроводки использовать нельзя.

Провода и кабели бывают одножильными и многожильными. Многожильные провода и кабели имеют в общей оболочке две и более надежно изолированные друг от друга жилы. Пример многожильного провода – провод марки ПРТО (провод с медной жилой с резиновой изоляцией в оплетке из хлопчатобумажной пряжи, пропитанной противогнилостным составом).

Жилы одножильных и многожильных проводов и кабелей могут изготавливаться однопроволочными и многопроволочными.

Кабели и провода отличаются друг от друга видом оболочки и названиями. Оболочка проводов и кабелей служит для защиты изоляции жил от воздействия света, влаги, различных химических веществ и предотвращения их от механических повреждений. В состав кабеля может входить броня, а оболочка позволяет прокладывать их в более неблагоприятных условиях окружающей среды.

Провода можно прокладывать только скрытым способом, при открытой прокладке – только в трубах и коробах. Кабели можно прокладывать открыто.

Самый популярный кабель для использования в домашней электропроводке – ВВГнг, реже используется кабель NYM и провод ПУНП.

Для подключения к этажному щитку лучше всего использовать кабель NYM. Этот же кабель используют для соединения этажного щитка с квартирным или комнатными щитками (при условии, что такие имеются). Обычно такие щитки организуются в частных коттеджах. Его же можно использовать для индивидуального подключения мощных потребителей. Таким кабелем можно делать и всю силовую разводку в квартире или доме, но так как он стоит дороже кабеля ВВГнг и провода ПУНП, то для этих целей его используют реже.

ВВГ – небронированный защищенный кабель с медными жилами, поливинилхлоридной изоляцией, в поливинилхлоридной оболочке. Кабель может применятся в сухих и влажных помещениях. Кабель ВВГ не расчитан на растяжение. Изолированне жилы кабеля ВВГ скручены и имеют отличительную окраску. Внутренняя оболочка не содержит заполнения в междужильном пространстве.

Обозначение «нг» в названии кабеля (ВВГнг) обозначает, что он не распространяет горение при прокладке в пучках (используется состав на основе огнеупорного пластиката). Если вместо кабеля ВВГнг будет использован кабель ВВГ, то в случае возгорания одного из кабелей пламя распространится и на другие кабели, вместо локализации очага пожара.

Кабель ВВГнг отличается большим разнообразием форм. Наиболее удобно использовать плоский кабель ВВГнг. Кроме этого он бывает еще круглый, квадратный, секторный, и даже треугольный.

Кабель НУМ (NYM) — выпускается по немецкому стандарту DIN 57250. Кабель может применятся внутри помещений при скрытой и открытой прокладке. Кабель NYM можно применять на воздухе, только вне прямого воздействия солнечного света. Кабель NYM обладает пониженной горючествью и газодымовыделением, что особенно важно для жилых помещений.

Кабель NYM состоит из медных жил, промежуточной оболочки из мелонаполненной резины и оболочки из неподдерживающей горения поливинилхлоридной изоляции. Использование в конструкции кабеля промежуточной оболочки позволяет легко и удобно разделывать кабель при монтаже, повышает его пожароопасность и увеличивает гибкость.

ПУНП — установочный плоский провод. Это наиболее дешевый провод из всей кабельно-проводниковой продукции, применяемой для монтажа электропроводки в быту. Провод ПУНП выпускается с двумя или тремя медными однопроволочными жилами и поливинилхлоридной изоляции в оболочке из ПВХ-пластиката. Жилы могут быть окрашены в разные цвета.

Провод ПУНП выпускается только плоским. Эти кабельно-проводниковые изделия используют как для силовых, так и для осветительных сетей. Во втором случае берут провода меньших сечений.

Я не реомендую при прокладке домашней электропроводки использовать провод ПУНП, так как изоляция этого провода выполнена из дешевых материалов и очень быстро теряет свои свойства при нагреве. При выборе кабеля для монтажа электропроводки отдавайте свое предпочтение кабелям марок ВВГнг или NYM.

Намного реже в домашней электропроводке используются провода с резиновой изоляцией марок ПРН, ПРИ, ПРТО. Провод ПРТО предназначен для прокладки в несгораемых трубах, ПРИ – можно применять для прокладки в сухих и сырых помещениях, ПРН (защищенный провод) — на открытом воздухе, ПРД, ПРВД (двухжильный скрученный провод) – только в осветительных сетях сухих помещений.

Для открытой проводки удобно использовать плоский провод с медными жилами и поливинилхлоридной изоляцией с разделительным основанием марки ППВ, а также провод с полиэтиленовой изоляцией ППП. Существует плоский провод без разделительного основания – ППВС, но им пользоваться не очень удобно.

Ранее применявшиеся провода с алюминиевыми жилами (АПР, АПВ, АПРТО, АППВ) сейчас при строительстве и модернизации домашней электропроводки не используются.

Провод с медной жилой и поливинилхлоридной изоляцией ПВ. Провода ПВ могут быть однопроволочными и многопроволочными. Провода выпускается с разным цветом изоляции. В бытовой электропровдке одножильный провод ПВ1 в желто-зеленой раскраске используется для системы уравнивания потенциалов (ДСУП).

Провода ПВ2, ПВ3 и ПВ4 используются для внутреннего монтажа в электрических щитках. Провода ПВ3 и ПВ4 обычно дороже, т.к. имеют более гибкую оболочку. Они применяются там, где необходимы изгибы проводов.

Для питания уличных светильников, выполнении ответвлений в траншеях под землей применяют бронированный кабель ВБбШв, или кабель с алюминиевыми жилами АВБбШв. Этот кабель защищен стальной лентой под слоем поливинилхлоридной изоляции.

Кабель ВБбШв выпускается с тремя, четырьмя и пятью проводящими жилами. Ранее для этих целей применялись кабель с медными жилами в поливинилхлоридной оболочке ВРГ и бронированные кабели с алюминиевыми жилами марок ААШв, ААБ, АВВБ и АВРБ.

Для воздушных ответвлений в наше время наиболее популярен самонесущий изолированный кабель (СИП). Существует большое количество разновидностей такого кабеля: СИП-2А, СИП-3, СИП-4. Кабель имеет жилы сталеалюминиевые жилы большой прочности. Жилы изолированы специальным светостабилизированным атмосферостойким полиэтиленом, который не разрушается на открытом воздухе.

Раньше для выполнения воздушных ответвлений широко использовались кабели АВВГ с обычной поливинилхлоридной изоляцией, которая под действием неблагоприятных факторов окружающей среды быстро становилась хркупкой и разрушалась. Применение самонесущего изолированного кабеля СИП решает эту проблему.

При выборе проводов и кабелей необходимо соблюдать требования ПУЭ по окраске изоляции.

Изоляция нулевого рабочего проводника должна быть голубого цвета, нулевого защитного – желто-зеленого. Цвет изоляции фазных проводников должен отличаться от цвета нулевых. Тут существует много вариантов – коричневый, красный, серый, белый, черный и т.д.

Также очень удобно использовать для каждого участка электропроводки свой цвет фазных проводников, а также разные цвета изоляции жил для силовой и осветительной электропроводки.

Если выбрать а затем и произвести монтаж электропроводки проводом или кабелем без соблюдения требований к расцветке жил, то в дальнейшем, это приведет к существенным трудностям при обслуживании и ремонте такой электропроводки, да и сам процесс монтажа может быть очень осложнен, особенно при использовании большого числа выключателей и розеток. Кроме этого, использование проводов и кабелей с изоляцией одного цвета является нарушением ПУЭ.

Чем отличается кабель ВВГ от кабеля NYM-J?

Современная электрическая распределительная низковольтная сеть монтируется в основном двумя распространёнными видами кабелей: ВВГ или NYM-J.

 

Общими у обоих типов являются:

  • наличие жил из меди;
  • ПВХ-оболочка.

 

Различия кабелей: ВВГ или NYM-J

Несмотря на схожесть кабели имеют различия. Провод NYM производится по европейским технологиям.

 

Расшифровка аббревиатур:

  • N — производство по стандарту VDE 0250, Y — с применением ПВХ, M — монтажный.
  • В — изоляция медной жилы ПВХ, В — наружная изоляция ПВХ, Г — голый провод без брони.

 

 

Различия по параметрам:

  1. Рабочее напряжение кабелей несколько различается. NYM работает при значениях напряжения до 660 Вольт, ВВГ может работать при напряжениях до 1 кВ.
  2. В оплетке наружной изоляции NYM-кабеля от 2 до 5 жил, сечением от 1,5-35 квадратных миллиметров, у ВВГ — от 1 до 5 жил сечением 1,5-240 квадратных миллиметров.
  3. Первый имеет несколько меньший диапазон рекомендованных температур эксплуатации (-30 — +40), второй — -50 — +50.
  4. NYM имеет заполнение между жилами внутри защитной оболочки, поэтому провод внешне имеет более правильную округлую форму, у ВВГ этого заполнителя нет.
  5. Установленный производителями срок службы первого составляет сорок лет, второго — всего тридцать.
  6. NYM-J не распространяет огонь только в случае одиночной прокладки, в то время как ВВГ при групповой прокладке.

 

 

Сфера применения 

С учетом перечисленного становится ясным, что для прокладки в жилых помещениях лучше подходят кабели NYM-J. Благодаря внутреннему негигроскопичному заполнителю и плотному прилеганиювнешней оболочки к внутренним изолированным жилам провод можно монтировать во влажных помещениях, постройках из дерева (дачных деревянных домиках, банях и т.д.).

 

При необходимости групповой прокладки в производственных комплексах, а также офисах лучше использовать ВВГ-провод. На открытом воздухе или в грунте предпочтительно прокладывать сети также этими кабелями. Причина в том, что на НИМ аналог разрушительно действуют солнечный свет и коррозионные свойства почвы.

 

Особенно это относится к продукции российских производителей, поскольку они изготавливают продукцию по техническим условиям, а не по стандартам VDE. Поэтому, вместо качественного заполнителя, может использоваться аналог со значительно худшими характеристиками (плохого качества). 

 

При монтаже внутри зон повышенной пожароопасности предпочтительно использовать силовые ВВГ-кабели, которые лучше отвечают современным стандартам и имеют повышенную устойчивость к возможному возгоранию в подобных местах. Это объясняется специальными добавками в ПВХ-пластикат внешней оболочки провода.

 

Для монтажа вводов в оборудование, где требуется максимальная герметизация, наоборот лучше использовать НИМ-кабель, он обеспечит повышенную безопасность при эксплуатации.

20 мая 2018г.

Электропроводка в квартире с использованием кабеля ВВГ

Перед началом электромонтажных работ многие нам задают вопрос, какой провод или кабель использовать для того, чтобы электропроводка в квартире была надежной. Начнем с того, что есть такие услуги электрика, как закупка материалов, возможно и с заказчиками. И действительно, при посещении магазина с материалами для электромонтажных работ особо выделяются стенды с множеством образцов различного рода проводов и кабелей. Все они конкретного назначения и предназначены для определенного вида работ. В большинстве случаев продавцы знают, какой провод лучше подойдет для электропроводки в квартире, но предлагают посоветоваться с электриком, который будет делать электромонтаж. Только электрик на собственном опыте знает, какие материалы использовать на конкретном объекте, чтобы проводка в квартире была надежной и долговечной.

Выбор кабеля для электропроводки в квартире.

При всем большом выборе проводов и кабелей на рынке электроматериалов больше всего для электромонтажа в квартире подходят два вида кабеля.

Это российский кабель ВВГ и немецкий NYM. Оба кабеля предназначены непосредственно для монтажа электропроводки. У кабеля ВВГ больше разновидностей и он более широко используется в электромонтаже. Кабель NYM уступает ВВГ в возможностях, но часто для электромонтажников он более легок в работе.

Можно встретить в магазинах кабель ПВС. Это круглый многожильный провод. Им пользуются в основном для небольших участков наружной проводки, временной проводки, для изготовления удлинителей, для подключения бытовых электроприборов.

Провода ПУНП, ПУНГП, ПУВП, ПБПП запрещено использовать в монтаже электропроводки в квартире. Они пожароопасные и ненадежные.

Делайте скрытую электропроводку в квартире с кабелем ВВГ.

Кабель ВВГ удобен для монтажа электропроводки. Особенно хорошо использовать кабель марки ВВГ нг (не горючий) в разводе проводов по автоматам в электрощите. При вводе в отверстия щита и в самом щите кабельзанимает немного меньше места, чем NYM. При нагревании проводов виниловая оболочка кабеля ВВГ нг не возгорается.

Вести кабель ВВГ в штробе тоже удобно. При изгибах виниловая изоляция кабеля не трескается. Это хорошо заметно в случае, когда проводка идет со стены на потолок к люстре и проходит сильный изгиб кабеля в углах, при этом виниловая оболочка на изгибе не белеет. Это хороший знак. Так же удобно соединять провода ВВГ в распаячных коробках электропроводки в доме.

Используйте при необходимости специальные марки кабеля.

Электропроводка в квартире будет надежнее, когда при групповой прокладке кабеля используется марка ВВГ нг. ВВГ нг в групповой укладке в штробе не воспламеняется и не поддерживает горение. Кабель ВВГ без буквенных дополнений не поддерживает горение только при одиночной прокладке в штробе, хотя и с ним проводка в квартире будет качественной.

Если на определенный участок электропроводки в доме будет подключаться повышенная нагрузка, кабель будет проложен по местам с высокой окружающей температурой, то лучше воспользоваться маркой ВВГ нг-frls. Аббревиатура Fr – это повышенная устойчивость к огню, ls – это малодымный. Или воспользуйтесь просто ВВГ нг-ls – не поддерживающий горение малодымный кабель.

Вот основные советы по использованию кабеля ВВГ если вы хотите, чтобы электропроводка в квартире у вас была надежной. Но лучше, когда вы все согласуете со знающим специалистом, с электриком. Выбирайте качественные услуги электрика. Ждем ваших звонков.

Скалин Евгений.

Запрошенная страница либо была удалена, либо ее не существовало. Если у Вас имеются закладки на данную страницу, просьба удалить их.

Для получения интересующей вас продукции, Вы можете воспользоваться поиском.

Также вы можете вернуться на предыдущую страницу и продолжить поиск продукции с нее.

Рекомедуемые продукты

Конвектор Adax 1000W мех/терм. 295мм Standard

Код продукта: 002103

7 692.35 Купить OTM160E3M230C 3п с мотр привод 230АС

Код продукта: 011526

54 760.00 Купить АД14 4п 10А С 30мА АC 4,5кА АД 14

Код продукта: 006566

1 171. 00 Купить трансформатор ТП 3 380 36В 4кВА

Код продукта: 002788

47 370.00 Купить ВНА/ТЕ П 10кВ 630А У2

Код продукта: 004589

17 944.00 Купить ВА 5735 125А 340010 РЭ1600А

Код продукта: 001917

4 969.00 Купить Дифф автомат DS202 AC C 16А 30мА

Код продукта: 002138

13 654.00 Купить Бокс Unibox-36-бел нав прозр дв

Код продукта: 001668

3 634.00 Купить Arctic 258 2х58Вт IP65 накладной

Код продукта: 006177

3 391.30 Купить MD 800 Вт 0,5×10,0

Код продукта: 011293

По запросу MS116 4. 0 50 кА

Код продукта: 006975

1 975.00 Купить ACS550-01-08A8-4 4 кВт 3ф IP21 (без панели управления)

Код продукта: 006706

51 460.00 Купить Конвектор Adax 600W мех/терм. 295мм Standard

Код продукта: 002102

6 024.85 Купить ВА 5739 500А 340010 РЭ5000

Код продукта: 001936

13 224.00 Купить ПВС 2х2,5

Код продукта: 000861

59.00 Купить ATV61 15КВТ 500В IP20

Код продукта: 013911

81 796.00 Купить

Рекомендуемые серии

  • HMMS
  • Силовые разъемы MENNEKES

Набор инструментов для резки кабеля типа НЙМ или ВВГ | Электрооборудование

Быстрый рост рынка электромонтажных работ предъявляет повышенные требования к электромонтажным инструментам. Когда речь идет о профессиональном электромонтаже, главными критериями выбора прибора, безусловно, являются: качество обрабатываемых материалов, простота использования, универсальность, надежность и срок службы устройства. Все это важные качественные инструменты, обеспечивающие установщику преимущество в скорости, значительно повышая производительность.

При всем разнообразии предлагаемого электромонтажного инструмента на данный момент определиться, выбрать подходящий вариант довольно сложно. Безусловным лидером в производстве профессионального инструмента для работы с кабелем и проводом является немецкая компания Weidmuller , известная многим как производитель качественного коммутационного оборудования.

Среди широкого ассортимента электроинструментов фирмы Weidmuller особую популярность у установщиков получил набор из двух инструментов для резки кабеля типа ВВГ или NYM.Для снятия внешней оболочки кабеля используется инструмент AM 25 , действующий по принципу дискового ножа; Для зачистки внутренней проводки используется инструмент для зачистки Stripax , имя которого стало синонимом профессионалов-линейщиков.

При резке кабелей и проводов обычными методами с использованием ножа и бокорезов от установщика требовались определенные навыки, а качество обработки не всегда было удовлетворительным, поэтому время установки напрямую зависит от используемого инструмента и способностей установщика.

Резка трехжильного кабеля типа NYM за 7 секунд (!) Неподготовленному человеку становится возможна с применением инструментов AM 25 и Stripax компании Weidmuller . Все, что требуется от установщика — это поставленная длина зачистки!

съемник AM 25 предназначен для работы с круглым кабелем с ПВХ изоляцией. Диаметр кабеля от 4,5 до 25 мм. Устройство состоит из удобной ручки, подпружиненной головки с возможностью точной регулировки выступающего лезвия (4.Толщина изоляции 5 мм), поворотный режущий механизм (от 90 ° до 0 ° относительно кабеля) и подпружиненный угол захвата. Эта оригинальная конструкция AM 25 позволяет вырезать участки изоляции в любом кабеле на мест. Возможность вращения плоскости ножа позволяет разрезать изоляцию по окружности кабеля, даже по спирали. Регулировка длины лезвия обеспечивает сохранность нижележащих слоев изоляции и экрана кабеля; при необходимости устройство можно отрегулировать на конце кабеля.В комплект AM 25 входит запасное лезвие, расположенное в рукоятке.

Еще одним важным инструментом для работы с проволокой является инструмент для снятия изоляции Stripax . Данное устройство позволяет снимать ПВХ изоляцию с одножильных и многопроволочных жил от 0,08 до 6 мм² без каких-либо регулировок. Все, что требуется установщик, это установить длину зачистки с помощью мобильного стоп провода (длина 20 мм). Кабели с многослойной изоляцией можно снимать за несколько «проходов» без промежуточной настройки.Также в этом инструменте присутствует резак, выполняющий «чистый» разрез без обрыва и заедания токоведущего проводника. Трудно представить себе какой-либо способ зачистки многожильных проводов сечением менее 1 мм², однако с помощью Stripax эта операция выполняется одним движением, при этом крайнего живого обрезания и растяжения нет.

Высокая производительность Stripax , обеспечивается особой конструкцией двух рабочих губок, ножей, которые состоят из пакетов по 30 пластин, закрепленных на основе эластичного пластика.Таким образом, с помощью лезвий для двусторонней резки под давлением ряд пластин упруго деформируется и изгибается вокруг профильной проволоки, разрезая изоляцию до контакта с проводником. Корпус инструмента из полиамида, армированного стекловолокном, что делает инструмент очень прочным, рассчитанным на работу в тяжелых условиях.

За счет применения производителя в производстве высококачественных материалов и инструментов Precision Mechanics, ресурс Stripax , производитель, составляет 350 тыс. Операций.Как и любое профессиональное оборудование, инструмент фирмы Weidmuller имеет относительно высокую стоимость, но в то же время является наиболее выгодным при расчете стоимости разовой сделки в соответствии с длительным сроком службы и высокой надежностью.

Кабели — Electraline

Постановление о строительных материалах (CPR) Норматив для кабелей

Наши кабели соответствуют новому нормативу CPR, который требует:
• Маркировка CE
• Декларация характеристик качества (DoP)
• Проверка нотифицированными органами NB
Новые кабели имеют совершенно иное поведение при возгорании по сравнению с существующими кабелями, чтобы свести к минимуму риски для людей и имущества за счет уменьшения опасности возгорания.

Держатель подвесного электрического кабеля

в термоусадочной пленке.

Более 40 наименований всего в одном метре!

Расположение одинарных или двойных роликовых конвейерных кабелей с описательной этикеткой кабеля.

Кабель H07V-U

Провод применяется для стационарного электрооборудования в осветительных и электрических сетях, а также для монтажа оборудования и машин с номинальным напряжением 450 В (для сетей до 450/750 В), частотой до 400 Гц или напряжением постоянного тока до 1000 В. .

H07V-K Кабель

Провод применяется для стационарного электрооборудования в осветительных и электрических сетях, а также для монтажа оборудования и машин с номинальным напряжением 450 В (для сетей до 450/750 В), частотой до 400 Гц или напряжением постоянного тока до 1000 В.

Кабель ВВГ

Кабель используется для передачи и распределения электроэнергии в стационарных установках, работающих на 0.Номинальное напряжение переменного тока 6 или 1 кВ, частота 50 Гц.

Кабель NAYY-J

Кабель предназначен для передачи и распределения электроэнергии в стационарных установках, работающих от номинального переменного напряжения 0,6 или 1 кВ, частоты 50 Гц.

Кабель ABC

Провод предназначен для ответвлений магистральных воздушных линий электропередачи и для настенной прокладки.Номинальное напряжение: 0,6 / 1 кВ. Частота: 50 Гц.

NYM Кабель

Для стационарной установки. Используется на открытом воздухе, в сухой, влажной и влажной среде, на открытом воздухе и в скрытых помещениях, а также в кирпичной кладке и бетоне, не подходит для заливки в затвердевший или сжатый бетон.

Кабель Hi-Fi

Кабели для HI-FI установок.

Коаксиальный кабель

Кабели для TV / SAT, TVCC и удлинители TV.

Телефон

Кабели для подключения телефонов и домофонов.

Информатика

Кабели для компьютеров LAN и патчкорды.

Кабель сигнализации

Кабели сигнальные для установки сигнализации.

Кабель силовой медный 660 / 1100В ВВГ ВВГнг ВВГНГ-ФРЛС для России

Применение

Конструкция:
1. Жила — медная, однопроволочная или многопроволочная, круглой или секторной формы 1 или 2 класса по ГОСТ 22483.
2.Утеплитель — ПВХ. Изолированные жилы многожильных кабелей имеют идентификационную окраску. Изоляция нейтрального провода синего цвета. Изоляция заземляющих жил двух цветов (желто-зеленая).
3. Скрутка — изолированные жилы двух-, трех-, четырех- и пятижильных кабелей скручиваются. Двухжильные кабели имеют жилы одной и той же площади. В трех-, четырех- и пятижильных кабелях все жилы имеют одинаковую площадь или один провод (заземляющий или нейтральный) меньшей площади.
4. Оболочка — ПВХ, кабели ВВнг в оболочке из негорючего ПВХ.

Применение:
Эти кабели предназначены для распределения электроэнергии в стационарных установках на номинальное переменное напряжение 0,66 кВ и 1 кВ 50 Гц. Предназначены для укладки как в сухих, так и во влажных производственных помещениях на специальных эстакадах, в сборках, а также на открытом воздухе. Кабели не рекомендуется закапывать в траншеи. Кабели
ВВГ при индивидуальной прокладке негорючие. Кабели
ВВГнг при прокладке пучками негорючие.

Технические характеристики:
Вид климатизации УХЛ, категория размещения — 1 и 5 по ГОСТ 15150-69.
Диапазон рабочих температур …………………………………………… от -500 до +500
Относительная влажность воздуха ………………………………………………… .. до 98%
Кабели прокладывать и монтировать без предварительного нагрева при температурах не ниже… -15
Минимальный радиус изгиба при прокладке: одножильные кабели ВВГ ………………………………………… ………… 10 наружных диаметров
Одножильные кабели ВВГнг ………………………………………………… .15 наружных диаметров
Многожильные кабели ……………………………… ……………………………..7,5 внешних диаметров
Номинальная частота ………………………………………………………………… 50 Гц
Испытательное напряжение переменного тока 50 Гц
Для 0,66 кВ ………… ……………………………… 3 кВ
На 1 кВ…. ………………………………………………………………………… 3,5 кВ
Длительно допустимая рабочая температура нагрева жилы …… ..… + 70

0,6 / 1 кВ Медный бронированный кабель

подходит для использования при номинальном переменном напряжении (U0 / U) 0,6 / 1 кВ 0,66 кВ

система передачи и распределительный контур. С металлическим слоем брони он подходит для открытых сетей, вспомогательных и вспомогательных цепей, в кабелепроводах, заглубленных прямо или в подземных каналах для зданий

, используемых на электростанциях, трансформаторных подстанциях, промышленных предприятиях, городских сетях и в других местах. электрические установки, такие же, как для подключения сигнальных устройств в промышленности, дорожном движении и т.п.

Изоляция:

XLPE или PVC

Преимущество использования (изоляция из сшитого полиэтилена):

Это намного лучше, чем все целевые характеристики силового кабеля с ПВХ изоляцией. недостатки физического и химического сшивания, и полностью достигает или превосходит значение технических свойств GB и IEC.

Допустимая макс. Рабочая температура кабельного проводника составляет 90 ℃, срочная превышающая рабочая температура составляет 130 ℃ при коротком замыкании (5 с), макс. температура проводника 250 ℃. Температура окружающей среды при прокладке кабеля должна быть не ниже 0 ℃. При прокладке при температуре ниже 0 ℃ кабель следует предварительно нагреть.

Радиус изгиба одножильного кабеля должен быть не менее 12-кратного общего диаметра кабеля; для многожильного кабеля — не менее 10-кратного габаритного диаметра кабеля.

Допустимая нагрузка по току большая и не ограничивается падением во время прокладки.

Идентификация ядра:

1 ядро: коричневый или синий
2 ядра: коричневый, синий
3 ядра: коричневый, черный, серый
4 ядра: синий, коричневый, черный, серый
5 сердечников: зеленый / желтый, синий, коричневый, черный, серый
Альтернативная идентификация жил: белые сердечники с черными номерами

* Возможна другая цветовая идентификация.

FAQ 1

Q 1 : Ваша компания — завод или торговая компания?
A: Мы фабрики более 20 лет в Китае.

Q 2 : Какие гарантии качества мы можем предоставить и как мы контролируем качество?
A: 100% контроль на сборочных линиях. Все средства контроля, проверки, оборудование, приспособления, общие производственные ресурсы и навыки проверяются, чтобы подтвердить, что они постоянно достигают требуемых уровней качества.

Q 3 : Каковы ваши условия оплаты?

A: Обычно мы принимаем 30% депозита T / T, баланс 70% перед доставкой в ​​качестве основных условий оплаты, и другие платежи также могут быть согласованы.

Также доступно торговое обеспечение на Alibaba.

Q 4 : Какой срок доставки?

A: Официальный заказ занимает 10-25 дней.

Q 5 : Могу ли я получить образцы?

A: Да, образец доступен для проверки качества и рыночных испытаний.

Q 6 : У вас есть товары на складе?

A: Да, некоторые общие мы будем держать на складе.

Q7; Каково ваше MOQ?
A: Это основано на типе кабеля или типа провода. Мы также принимаем небольшие заказы.

Q8; Где находится ваш завод ?
A: мы находимся в провинции Хэнань, в центре Китая.

Нажмите

эвм.model.ctg8.22 | GDR

Отношения

Эта мРНК является частью следующей функции гена :

Эта мРНК является членом следующей функции syntenic_region :

Эта мРНК ортологична следующей функции мРНК :

Эта мРНК ортологична следующему гену признак (и):

Следующие мРНК признак (ы) ортологичны этой мРНК:

Следующие экзона особенности являются частью эта мРНК:

Название функции Уникальное имя Виды Тип
evm. model.ctg8.22.exon1 evm.model.ctg8.22.exon1_FnuScbg_v1.0 Fragaria nubicola экзон
evm.model.ctg8.22.exon2 evm.model.ctg8.22.exon2 22.exon2_FnuScbg_v1.0 Fragaria nubicola экзон

Следующие функции CDS являются частью этой мРНК:

Название функции Уникальное имя Виды Тип
компакт-дисков.evm.model.ctg8.22 cds.evm.model.ctg8.22_FnuScbg_v1.0 Fragaria nubicola CDS

Следующий полипептид является производным от этого полипептида : Название функции Уникальное название Виды Тип evm.model.ctg8.22 evm.model.ctg8.22_FnuScbg_v1.0-protein 9ubicola

Анализы

Эта мРНК получена или имеет результаты следующих анализов

Гомология

ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с NCBI №
Соответствие: gi | 764558672 | ref | XP_004294257.2 | (ПРОГНОЗ: цитохром P450 86A1 [Fragaria vesca subsp. Vesca])

HSP 1 Оценка: 1066,22 бит (2756), ожидание = 0,000e + 0
Идентичность = 516/520 (99,23%), положительные результаты = 517/520 ( 99,42%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLDGPGLVATSA 520
            METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWK + QNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRG DPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVY QPRKLDG GLVATSA
Sbjct: 34 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKIQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGSDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYLQPRKLDGLGLVATSA 553 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с NCBI №
Матч: gi | 1366011706 | ref | XP_024158821.1 | (цитохром P450 86A1 [Rosa chinensis])

HSP 1 Оценка: 1030,01 бит (2662), ожидание = 0,000e + 0
Идентичность = 495/520 (95,19%), положительные результаты = 510/520 (98,08%), запрос Кадр = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLDGPGLVATSA 520
            METLTLFFTLAAATS + Y + FWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQG FTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA + KDHT VDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSF + WKLQN FDLG + EKQL + RSLA + VGNYMD + АВА RKARPSDDLISRF + NKRDVDGNPFPSSVLQ IALNFVLAGRDTSSVALSWFFWLVMNNPE + Ed IVNEIT + VLSETRG DPKLWVEEPLVFDEA + KLVYLKAALAETLRLYPSVPLDFKYV + NDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSD + TRFEPPKD YKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMK + GLKVY QPRKLDGPG ватса
Sbjct: 1 METLTLFFTLAAATSLYFFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGLFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAAKDHTAVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFLWKLQNTFDLGSEKQLRRSLAIVGNYMDDAVADRKARPSDDLISRFLNKRDVDGNPFPSSVLQHIALNFVLAGRDTSSVALSWFFWLVMNNPEVEDKIVNEITTVLSETRGIDPKLWVEEPLVFDEAEKLVYLKAALAETLRLYPSVPLDFKYVINDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDQTRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKHGLKVYMQPRKLDGPGRVATSA 520 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с NCBI №
Соответствие: gi | 1220060162 | ref | XP_021816313.1 | (цитохром P450 86A1-подобный [Prunus avium])

HSP 1 Оценка: 934,095 бит (2413), Expect = 0,000e + 0
Идентичность = 448/521 (85,99%), Postives = 480/521 (92,13%) , Кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL-DGPGLVATSA 520
            METL + FTL AT + Y FWFYLLARKLTGP ПТВ + GSLPVLF НаРа IHDWI SNLRATGGSSTYQTCT + ALPFLARKQG + FTVTC + PKNIEHILRTRFDNYPKGP + WQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA + KDH VDLQDLLLRLTFDNICGLTFGKDPETLSP + LPDNPF + KAFDNATE TLQRLLYPSF + W + LQ F LGAE + QL ++ SL В. В. NYM + EA + АРКА PSDDLISRFMNKRDVDGNPFPS + VLQRIALNFVLAGRDTSSVALSWFF + LVMNNP + IE IV EI ++ VL TRG D + LW + EEPLVFDEADKLVYLKAALAETLRLYPSVP DFKYVVNDDVLPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKPDRW + S + D RFEPPKDSYKFLLGMKDRFEPPKDSYKFVAFNAGRLASPKDSYKFVAFNAGR1
Sbjct: 1 METLPILFTLFGATFLYLFWFYLLARKLTGPTVWPFLGSLPVLFMNRNSIHDWITSNLRATGGSSTYQTCTLALPFLARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAAKDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELPDNPFAKAFDNATEGTLQRLLYPSFLWRLQKIFGLGAERQLEKSLRVVENYMNEAIVARKATPSDDLISRFMNKRDVDGNPFPSAVLQRIALNFVLAGRDTSSVALSWFFYLVMNNPQIEAKIVGEISTVLKSTRGDDQRLWLEEPLVFDEADKLVYLKAALAETLRLYPSVPEDFKYVVNDDVLPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPDRWISADGNRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGFRAQQKMSLTLFMKNGLQVYLHPRQLGGGPGQVAATS 521 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с NCBI №
Соответствие: gi | 1162561610 | ref | XP_007208647.2 | (цитохром P450 86A1 [Prunus persica]> gi | 1139765204 | gb | ONH99966. 1 | гипотетический белок PRUPE_6G060200 [Prunus persica])

HSP 1 Оценка: 929,858 бит (2402), ожидание = 0,000e + 0 447 Идентичность / 521 (85,80%), положительные = 478/521 (91,75%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL-DGPGLVATSA 520
            METL + FTL AT + Y FWFYLLARKLTGP ПТВ VGSLPVLF НаРа IHDWI SNLRATGGSSTYQTCT + ALPFLARKQG + FTVTC + PKNIEHILRTRFDNYPKGP + WQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA + KDH VDLQDLLLRLTFDNICGLTFGKDPETLSP + LPDNPF + KAFDNATE TLQRLLYPSF + W + LQ F LGAE + QL ++ SL В. В. NYM + EA + АРКА PSDDLISRFMNKRDVDGN FPS + VLQRIALNFVLAGRDTSSVALSWFF + LVMNNP IE IV EI ++ VL TRG D + LW + EEPLVFDEADKLVYLKAALAETLRLYPSVP DFKYVVNDDVLPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKP + RW + S + D RFEPPKD YKFLAVAFKS GPLASGTCMEFKP + RW + S + D RFEPPKD YKFLAVAFRLA
Sbjct: 1 METLPILFTLFGATFLYLFWFYLLARKLTGPTVWPFVGSLPVLFMNRNSIHDWITSNLRATGGSSTYQTCTLALPFLARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAAKDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELPDNPFAKAFDNATEGTLQRLLYPSFLWRLQKTFGLGAERQLEKSLRVVENYMNEAIVARKATPSDDLISRFMNKRDVDGNHFPSAVLQRIALNFVLAGRDTSSVALSWFFYLVMNNPLIEAKIVGEISTVLKSTRGDDQRLWLEEPLVFDEADKLVYLKAALAETLRLYPSVPEDFKYVVNDDVLPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPERWISADGNRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGFRAQQKMSLTLFMKNGLQVYLHPRQLGGGPGLVAATS 521 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с NCBI №
Соответствие: gi | 645216306 | ref | XP_008220520.1 | (ПРОГНОЗ: цитохром P450 86A1 [Prunus mume])

HSP 1 Оценка: 928,317 бит (2398), Expect = 0,000e + 0
Идентичность = 445/521 (85,41%), Postives = 478/521 (91,75%) , Кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL-DGPGLVATSA 520
            METL + FTL AT + Y FWFYLLARKLTGP ПТВ VGSLPVLF НаРа IHDWI SNLRATGGSSTYQTCT + ALPFLARKQG + FTVTC + PKNIEHILRTRFDNYPKGP + WQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIR RLWCILDKA + KDH VDLQDLLLRLTFDNICGLTFGKDPETLSP + LPDNPF + KAFDNATE + TLQRLLYPSF + W + F LQ LGAE ++ L ++ SL В. В. NYM + Е.А. + АРКА PSDDLISRFMNKRDVDGNPFPS + VLQRIALNFVLAGRDTSSVALSWFF LVMNNP + IE IV EI ++ VL TRG D + LW + EEPLVFDEADKLVYLKAALAETLRLYPSVP DFKYVVNDDVLPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKP + RW + S + D RFEPPKDGPLASKDGLVLKDVL + DRFAVLGKRLVL + DRAVLAKDVL + DRFAVLAKDKRLA
Sbjct: 1 METLPILFTLLGATFLYLFWFYLLARKLTGPTVWPFVGSLPVLFMNRNSIHDWITSNLRATGGSSTYQTCTLALPFLARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRTRLWCILDKAAKDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELPDNPFAKAFDNATESTLQRLLYPSFLWRLQKTFGLGAERRLEKSLRVVENYMNEAIVARKATPSDDLISRFMNKRDVDGNPFPSAVLQRIALNFVLAGRDTSSVALSWFFNLVMNNPQIEAKIVGEISTVLKSTRGDDQRLWLEEPLVFDEADKLVYLKAALAETLRLYPSVPEDFKYVVNDDVLPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPERWISADGNRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGFRAQQKMSLTLFMKNGLQVYLHPRQLGGGPGQVAATS 521 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с NCBI №
Соответствие: gi | 658046618 | ref | XP_008358971.1 | (ПРОГНОЗ: цитохром P450 86A1-подобный [Malus domestica])

HSP 1 Оценка: 913,679 бит (2360), ожидание = 0,000e + 0
Идентичность = 434/521 (83,30%), положительные результаты = 474/521 (90,98 %), Кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLD-GPGLVATSA 520
            METL + L AATSVY FWFYLLARKLTGP VWPVVGSLP + L ++ NR + IHDWI SNLRATGGS + TYQTCT + ALPF + ARKQG ++ ТВТ + PKNIEHILR RFDNYPKGP + WQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA + DH VDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPF + KAFDNATEATLQRLLYP + F + W ++ QF LGAE + QL ++ SL ВВГ + УМ + + AVAARK PSDDLISRFMNKRDVDGNPFPS + VLQRIALNFVLAGRDTSSVALSWFF L + M NP И. Е. + I + EI + VL + ТРГ DP + LW EEPL FDEADKLVYLKAALAETLRLYPSVP DFKYVV DDVLPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKP + RW, + S + D RFEPPKD YKFVAFN GPRTCLGKDLAYLQMKSV SAVLLRYRLSPVPG R QKMSLTLFMK GL + V + PRKL ГПГ В.А. ++
Sbjct: 1 METLPILSALFAATSVYLFWFYLLARKLTGPSVWPVVGSLPLLYSNRKQIHDWITSNLRATGGSATYQTCTLALPFVARKQGLYTVTSNPKNIEHILRARFDNYPKGPTWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAERDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFAKAFDNATEATLQRLLYPAFLWRIQKFFGLGAERQLEKSLKVVGDYMNDAVAARKLTPSDDLISRFMNKRDVDGNPFPSAVLQRIALNFVLAGRDTSSVALSWFFHLIMENPHIEEKIIAEISKVLKQTRGDDPRLWTEEPLAFDEADKLVYLKAALAETLRLYPSVPEDFKYVVKDDVLPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPERWISADGNRFEPPKDGYKFVAFNGGPRTCLGKDLAYLQMKSVVSAVLLRYRLSPVPGFRAQQKMSLTLFMKKGLQVHLHPRKLGVGPGHVAATS 521 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с NCBI №
Соответствие: gi | 694398158 | ref | XP_009374269.1 | (ПРОГНОЗ: цитохром P450 86A1 [Pyrus x bretschneideri])

HSP 1 Оценка: 904,049 бит (2335), Expect = 0,000e + 0
Идентичность = 430/512 (83,98%), Postives = 472/512 (92,19%) ), Кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLDG 512
            METL + FL А. А. В.Я. FWFYLLARKLTGP VWPVVGS + Р + LF NR + IHDWI SNLRATGGS + TYQTCT + ALPF + ARKQG + FTVTC + PKNIEHILRTRFDNYPKGP ++ QAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA ++ DH VDLQDLLLRLTFDNICGLTFGKDPETLSP + LPDNPFSKAFDNATEATL + RLLYPSF + W ++ Q LGAE + QL ++ SL ВВГ + Ю.М. ++ AVAARK PSDDLISRFMNKRDVDGN FPS + VLQRIALNFVLAGRDTSSVALSWFF LVM NP + И.Е. + И.В. ЭИ ++ В.Л. + ТРГ DP + ЛЖИ + EPLVFDEAD + LVYLKAAL + ETLRLYPSVP DFKYVVNDD + LPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKPDRW + S + D + FEPPKD YKF + AFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLS ВПГ R QKMSLTLFMK GL + В.Я. ФРК грамм
Sbjct: 1 METLPIFSALFAAAFVYLFWFYLLARKLTGPSVWPVVGSIPFLFSNRKQIHDWITSNLRATGGSATYQTCTLALPFVARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTYQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAARDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELPDNPFSKAFDNATEATLKRLLYPSFLWRIQKLLGLGAERQLEKSLKVVGDYMNDAVAARKLTPSDDLISRFMNKRDVDGNQFPSAVLQRIALNFVLAGRDTSSVALSWFFHLVMENPQIEEKIVAEISTVLKQTRGDDPRLWVKEPLVFDEADRLVYLKAALSETLRLYPSVPEDFKYVVNDDILPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPDRWISAD-GKFEPPKDGYKFMAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGFRAQQKMSLTLFMKNGLQVYLHPRKFGG 511 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с NCBI №
Соответствие: gi | 1098801834 | ref | XP_018806725.1 | (ПРОГНОЗ: цитохром P450 86A1 [Juglans regia])

HSP 1 Оценка: 900,968 бит (2327), ожидание = 0,000e + 0
Идентичность = 426/512 (83,20%), положительные результаты = 468/512 (91,41%) , Кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLDG 512
            METL + F + AAA SY FWFYLLA + KLTGPKVWPVVGSLP LF NR + RIHDW + ASNLRATGGS + TYQTCT + PFLA KQG FTVTCHPKNIEH + LRTRF + NYPKGP WQAAFHDLLG + GIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIR RLW ILDKA + KD + T VDLQDLLLRLTFDNICGLTFGKDPETLS DLP + НРП + AFD ATEATLQRLLYP F + W + F + G E ++ LK С.  Л. В. NYM ++, А + AARK PSDDL + SRFMNKRDVDGNPFP SVLQRIALNFVLAGRDTSSVALSWFFWLVM ++ PE + Е + Ni + EI ++ В.Л. ETRG D + W + EEPLVFDEAD + LVYLKAALAETLRLYPSVP DFKYVV + DDVLPDGTFVP + GSTVTYSIYSVGRMKTIWGEDCMEFKP + RWLS ++ RFEPPKD YKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRV QKMSLTLFMK GL + В.Я. + PR + Л.Г.
Sbjct: 1 METLPILFGIAAAASAYLFWFYLLAQKLTGPKVWPVVGSLPALFLNRSRIHDWMASNLRATGGSATYQTCTMPFPFLASKQGFFTVTCHPKNIEHVLRTRFENYPKGPDWQAAFHDLLGQGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRTRLWYILDKAAKDNTSVDLQDLLLRLTFDNICGLTFGKDPETLSLDLPNNPFAIAFDTATEATLQRLLYPGFLWRFEKVFCIGTERRLKESLQVVENYMNDAIAARKESPSDDLLSRFMNKRDVDGNPFPMSVLQRIALNFVLAGRDTSSVALSWFFWLVMHHPEVEENIIKEISTVLKETRGDDHRKWIEEPLVFDEADRLVYLKAALAETLRLYPSVPEDFKYVVSDDVLPDGTFVPAGSTVTYSIYSVGRMKTIWGEDCMEFKPERWLSAEGDRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVEQKMSLTLFMKNGLRVYLRPRQLQG 512 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с NCBI №
Соответствие: gi | 1009114673 | ref | XP_015873811.1 | (ПРОГНОЗ: цитохром P450 86A1 [Ziziphus jujuba])

HSP 1 Оценка: 900,197 бит (2325), ожидание = 0,000e + 0
Идентичность = 428/512 (83,59%), положительные результаты = 463/512 (90,43%) , Кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLDG 512
            METL F TLAAA + В. Я. FWFYLLA + KLTGPK WPVVGSLP LF NR RIHDWIASNLR + TGG + STYQTCTIALPFLA KQG FTVTCHPKNIEHILRTRFDNYPKGP + WQAAFHDLLG + GIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTI + NRLWCILDKASK + VDLQDLLLRLTFDNICGLTFGKDPETLS + LP + Н Ж + ФАР ATEATLQRLLYP FVW + Q + G ЭК + ЛК SL + V, NYM ++, А.В. КОВЧЕГ PSDDLISRFM KRDVDGN FP + SVLQRIALNFVLAGRDTSSVALSWFFWLVMN + P + ЭД IVNEI ++ В.Л. ETRG D + W ++ EPLVFDEADKLVYLKAALAETLRLYPSVP ДФК + В. + DDVLPDGTFVPSGST + TYSIY + VGRMKTIWGEDCMEFKP + RW, + S + RFEPPKD YKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLS VPGHRV QKMSLTLFMK GL + В.Я. ПР + L + G,
Sbjct: 1 METLPCFLTLAAASCVYLFWFYLLAQKLTGPKAWPVVGSLPALFMNRRRIHDWIASNLRSTGGTSTYQTCTIALPFLANKQGFFTVTCHPKNIEHILRTRFDNYPKGPNWQAAFHDLLGQGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIKNRLWCILDKASKEKISVDLQDLLLRLTFDNICGLTFGKDPETLSVELPENQFAMAFDTATEATLQRLLYPGFVWRFQKLLGIGVEKKLKSSLQIVENYMNDAVEARKENPSDDLISRFMKKRDVDGNSFPTSVLQRIALNFVLAGRDTSSVALSWFFWLVMNHPHVEDKIVNEISTVLRETRGDDHRKWLDEPLVFDEADKLVYLKAALAETLRLYPSVPQDFKFVVSDDVLPDGTFVPSGSTITYSIYAVGRMKTIWGEDCMEFKPERWISAQGDRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGHRVEQKMSLTLFMKNGLRVYLNPRELEG 512 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с NCBI №
Соответствие: gi | 657951968 | ref | XP_008355259.1 | (ПРОГНОЗ: цитохром P450 86A1 [Malus domestica])

HSP 1 Оценка: 899,042 бит (2322), ожидание = 0,000e + 0
Идентичность = 432/521 (82,92%), положительные результаты = 475/521 (91,17%) , Кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL-DGPGLVATSA 520
            ME L + FL А.А. SVY FWFYLLARKLTGP VWPVVGS + Р + LF NR + IHDWI + NLRATG S + TYQTCT + ALPFLAR + QG + FTVTC + PKNIEHILRTRFDNYPKGP ++ QAAFHDLLGEGIFNSDGETWL QRKTAALEFTTRTLRQAMARWVNRTIRNRLW ILDKA ++ DH VDLQDLLLRLTFDNICGLTFGKDPETLSP + LPDNPFSKAFDNATEATL + RLLYPSF + W ++ QF LGAE + QL + + SL ВВГ + YM ++ AVAARK PSDDLISRFMNKRD + DGN FPS + VLQRIALNFVLAGRDTSSVALSWFF LVM NP + И. Е. + И.В. ЭИ ++ В.Л. + ТРГ DP + ЛЖИ + EPLVFDEADKLVYLKAAL + ETLRLYPSVP DFKYVVNDD + LPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKPDRW + S + D + FEPPKD YKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLS ВПГ R QKMSLTLFMK GL + ВЫ ПРКЛ ГП В + А
Sbjct: 1 MEALPIFSALFAAASVYLFWFYLLARKLTGPSVWPVVGSIPFLFSNRXQIHDWITNNLRATGXSATYQTCTLALPFLARRQGLFTVTCNPKNIEHILRTRFDNYPKGPTYQAAFHDLLGEGIFNSDGETWLTQRKTAALEFTTRTLRQAMARWVNRTIRNRLWFILDKAARDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELPDNPFSKAFDNATEATLKRLLYPSFLWRIQKLFGLGAERQLEKSLEVVGDYMNDAVAARKLTPSDDLISRFMNKRDIDGNXFPSAVLQRIALNFVLAGRDTSSVALSWFFHLVMENPQIEEKIVAEISTVLKQTRGDDPRLWVKEPLVFDEADKLVYLKAALSETLRLYPSVPEDFKYVVNDDILPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPDRWISAD-GKFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGFRAQQKMSLTLFMKDGLQVYLHPRKLGGGPDQVTQAA 520 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с ExPASy TrEMBL
Соответствие: A0A5E4FX29_PRUDU (ПРОГНОЗ: цитохром P450 OS = Prunus dulcis OX = 3755 GN = ALMOND_2B024150 PE = 3 SV = 1)

HSP 1 Оценка: 930,628 бит (2404), ожидание = 0,000e + 0 44 521 (85,80%), положительные = 478/521 (91,75%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL-DGPGLVATSA 520
            METL + FTL AT + Y FWFYLLARKLTGP ПТВ VGSLPVLF НаРа IHDWI SNLRATGGSSTYQTCT + ALPFLARKQG + FTVTC + PKNIEHILRTRFDNYPKGP + WQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA + KDH VDLQDLLLRLTFDNICGLTFGKDPETLSP + LPDNPF + KAFDNATE TLQRLLYPSF + W + LQ F LGAE + QL ++ SL В. В. NYM + EA + АРКА PSDDLISRFMNKRDVDGN FPS + VLQRIALNFVLAGRDTSSVALSWFF + LVMNNP + IE IV EI ++ VL TRG D + LW + EEPLVFDEADKLVYLKAALAETLRLYPSVP DFKYVVNDDVLPDGTFVP + GSTVTYSIYSVGRMK IWGEDCMEFKP + RW + S + D RFEPPKD YKFLVAFKDA
Sbjct: 1 METLPILFTLFGATFLYLFWFYLLARKLTGPTVWPFVGSLPVLFMNRNSIHDWITSNLRATGGSSTYQTCTLALPFLARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAAKDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELPDNPFAKAFDNATEGTLQRLLYPSFLWRLQKTFGLGAERQLEKSLRVVENYMNEAIVARKATPSDDLISRFMNKRDVDGNHFPSAVLQRIALNFVLAGRDTSSVALSWFFYLVMNNPQIEAKIVGEISTVLKSTRGDDQRLWLEEPLVFDEADKLVYLKAALAETLRLYPSVPEDFKYVVNDDVLPDGTFVPAGSTVTYSIYSVGRMKCIWGEDCMEFKPERWISADGNRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGFRAQQKMSLTLFMKNGLQVYLHPRQLGGGPGLVAATS 521 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с ExPASy TrEMBL
Соответствие: M5W945_PRUPE (не охарактеризованный белок (фрагмент) OS = Prunus persica OX = 3760 GN = PRUPE_ppa020227 мг PE = 3 SV = 1)

HSP 1 Оценка : 930,243 бит (2403), Expect = 0,000e + 0
Identity = 447 / 521 (85,80%), положительные = 478/521 (91,75%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL-DGPGLVATSA 520
            METL + FTL AT + Y FWFYLLARKLTGP ПТВ VGSLPVLF НаРа IHDWI SNLRATGGSSTYQTCT + ALPFLARKQG + FTVTC + PKNIEHILRTRFDNYPKGP + WQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA + KDH VDLQDLLLRLTFDNICGLTFGKDPETLSP + LPDNPF + KAFDNATE TLQRLLYPSF + W + LQ F LGAE + QL ++ SL В. В. NYM + EA + АРКА PSDDLISRFMNKRDVDGN FPS + VLQRIALNFVLAGRDTSSVALSWFF + LVMNNP IE IV EI ++ VL TRG D + LW + EEPLVFDEADKLVYLKAALAETLRLYPSVP DFKYVVNDDVLPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKP + RW + S + D RFEPPKD YKFLAVAFKS GPLASGTCMEFKP + RW + S + D RFEPPKD YKFLAVAFRLA
Sbjct: 4 METLPILFTLFGATFLYLFWFYLLARKLTGPTVWPFVGSLPVLFMNRNSIHDWITSNLRATGGSSTYQTCTLALPFLARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAAKDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELPDNPFAKAFDNATEGTLQRLLYPSFLWRLQKTFGLGAERQLEKSLRVVENYMNEAIVARKATPSDDLISRFMNKRDVDGNHFPSAVLQRIALNFVLAGRDTSSVALSWFFYLVMNNPLIEAKIVGEISTVLKSTRGDDQRLWLEEPLVFDEADKLVYLKAALAETLRLYPSVPEDFKYVVNDDVLPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPERWISADGNRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGFRAQQKMSLTLFMKNGLQVYLHPRQLGGGPGLVAATS 524 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с ExPASy TrEMBL
Соответствие: A0A251NKV8_PRUPE (не охарактеризованный белок OS = Prunus persica OX = 3760 GN = PRUPE_6G060200 PE = 3 SV = 1)

HSP 1 Оценка : 929,858 бит (2402), Expect = 0,000e + 0
Identity (447/521) 85,80%), положительные результаты = 478/521 (91,75%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL-DGPGLVATSA 520
            METL + FTL AT + Y FWFYLLARKLTGP ПТВ VGSLPVLF НаРа IHDWI SNLRATGGSSTYQTCT + ALPFLARKQG + FTVTC + PKNIEHILRTRFDNYPKGP + WQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA + KDH VDLQDLLLRLTFDNICGLTFGKDPETLSP + LPDNPF + KAFDNATE TLQRLLYPSF + W + LQ F LGAE + QL ++ SL В. В. NYM + EA + АРКА PSDDLISRFMNKRDVDGN FPS + VLQRIALNFVLAGRDTSSVALSWFF + LVMNNP IE IV EI ++ VL TRG D + LW + EEPLVFDEADKLVYLKAALAETLRLYPSVP DFKYVVNDDVLPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKP + RW + S + D RFEPPKD YKFLAVAFKS GPLASGTCMEFKP + RW + S + D RFEPPKD YKFLAVAFRLA
Sbjct: 1 METLPILFTLFGATFLYLFWFYLLARKLTGPTVWPFVGSLPVLFMNRNSIHDWITSNLRATGGSSTYQTCTLALPFLARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAAKDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELPDNPFAKAFDNATEGTLQRLLYPSFLWRLQKTFGLGAERQLEKSLRVVENYMNEAIVARKATPSDDLISRFMNKRDVDGNHFPSAVLQRIALNFVLAGRDTSSVALSWFFYLVMNNPLIEAKIVGEISTVLKSTRGDDQRLWLEEPLVFDEADKLVYLKAALAETLRLYPSVPEDFKYVVNDDVLPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPERWISADGNRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGFRAQQKMSLTLFMKNGLQVYLHPRQLGGGPGLVAATS 521 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с ExPASy TrEMBL
Соответствие: A0A498IRE9_MALDO (не охарактеризованный белок OS = Malus domestica OX = 3750 GN = DVh34_033038 PE = 3 SV = 1)

HSP 1 Оценка: 914,45 бит (2362), Expect = 0,000e + 0
Identity = 434/521 ( 83,30%), положительные результаты = 475/521 (91,17%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLD-GPGLVATSA 520
            METL + L AATSVY FWFYLLARKLTGP VWPVVGSLP + L ++ NR + IHDWI SNLRATGGS + TYQTCT + ALPF + ARKQG ++ ТВТ + PKNIEHILR RFDNYPKGP + WQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA + DH VDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPF + KAFDNATEATLQRLLYP + F + W ++ QF LGAE + QL ++ SL ВВГ + УМ + + AVAARK PSDDLISRFMNKRDVDGNPFPS + VLQRIALNFVLAGRDTSSVALSWFF L + M NP И. Е. + I + ЭИ ++ В.Л. + ТРГ DP + LW EEPL FDEADKLVYLKAALAETLRLYPSVP DFKYVV DDVLPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKP + RW, + S + D RFEPPKD YKFVAFN GPRTCLGKDLAYLQMKSV SAVLLRYRLSPVPG R QKMSLTLFMK GL + V + PRKL ГПГ В.А. ++
Sbjct: 1 METLPILSALFAATSVYLFWFYLLARKLTGPSVWPVVGSLPLLYSNRKQIHDWITSNLRATGGSATYQTCTLALPFVARKQGLYTVTSNPKNIEHILRARFDNYPKGPTWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAERDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFAKAFDNATEATLQRLLYPAFLWRIQKFFGLGAERQLEKSLKVVGDYMNDAVAARKLTPSDDLISRFMNKRDVDGNPFPSAVLQRIALNFVLAGRDTSSVALSWFFHLIMENPHIEEKIIAEISTVLKQTRGDDPRLWTEEPLAFDEADKLVYLKAALAETLRLYPSVPEDFKYVVKDDVLPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPERWISADGNRFEPPKDGYKFVAFNGGPRTCLGKDLAYLQMKSVVSAVLLRYRLSPVPGFRAQQKMSLTLFMKKGLQVHLHPRKLGVGPGHVAATS 521 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с ExPASy TrEMBL
Соответствие: A0A5N5FVA8_9ROSA (Cytochrome P450 86A1-подобная ОС = Pyrus ussuriensis x Pyrus communis OX = 2448454 GN = D8674_006766 PE = 3 SV = 1)

HSP 1 Оценка: 912,909 бит (2358), + 0 Идентичность = 433/521 (83,11%), положительные результаты = 476/521 (91,36%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL-DGPGLVATSA 520
            ME L + AATSVY FWFYLLARKLTGP VWPVVGSLP L ++ NR + IHDWI SNLRATGGS + TYQTCT + ALPFLARKQG ++ ТВТ + PKNIEHILRTRFDNYPKGP + WQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA ++ DH VDLQDLLLRLTFDNICGLTFGKDPETLSP + L DNPF + KAFDNATEATLQRLLYP + F + W ++ QF LGAE + QL ++ SL + VG + YM ++ AVAARK PSDDLISRFMNKRDVDGNPFPS + VLQRIALNFVLAGRDTSSVALSWFF L + M NP И. Е. + I + ЭИ ++ В.Л. + ТРГ DP + LW EEPLVFDEADKLVYLKAALAETLRLYPSVP DFKYVV DDVLPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKP + RW, + S + D RFEPP + D YKFVAFNAGPRTCLGKDLAYLQMKSV SAVLLRYRLSPVPG R QKMSLTLFMK GL + V + PRKL ГПГ В.А. ++
Sbjct: 1 MEALPILSALFAATSVYLFWFYLLARKLTGPSVWPVVGSLPFLYSNRKQIHDWITSNLRATGGSATYQTCTLALPFLARKQGLYTVTSNPKNIEHILRTRFDNYPKGPTWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAARDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELSDNPFAKAFDNATEATLQRLLYPAFLWRIQKFFGLGAERQLEKSLKIVGDYMNDAVAARKLTPSDDLISRFMNKRDVDGNPFPSAVLQRIALNFVLAGRDTSSVALSWFFHLIMENPHIEEKIIAEISTVLKQTRGDDPRLWTEEPLVFDEADKLVYLKAALAETLRLYPSVPEDFKYVVKDDVLPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPERWMSADGNRFEPPQDGYKFVAFNAGPRTCLGKDLAYLQMKSVVSAVLLRYRLSPVPGFRAQQKMSLTLFMKNGLRVHLHPRKLGGGPGSVAATS 521 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с ExPASy TrEMBL
Соответствие: A0A540MQA3_MALBA (неохарактеризованный белок OS = Malus baccata OX = 106549 GN = C1h56_013505 PE = 3 SV = 1)

HSP 1 Оценка : 911,368 бит (2354), Expect = 0,000e + 0
Identity (432/5 82,92%), положительные = 475/521 (91,17%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL-DGPGLVATSA 520
            ME L + AATSVY FWFYLLARKLTGP VWPVVGSLP + L ++ NR + IHDWI SNLRATGGS + TYQTCT + ALPF + ARKQG ++ ТВТ + PKNIEHILRTRFDNYPKGP + WQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA + DH VDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPF + KAFDNATEATLQRLLYP + F + W ++ QF LGAE + QL ++ SL ВВГ + УМ + + AVAARK PSDDLISRFMNKRDVDGNPFPS + VLQRIALNFVLAGRDTSSVALSWFF L + M NP И. Е. + I + ЭИ ++ В.Л. + ТРГ DP + LW EEPL FDEADKLVYLKAALAETLRLYPSVP DFKYVV DDVLPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKP + RW, + S ++ RFEPPK + YKFVAFN GPRTCLGKDLAYLQMKSV SAVLLRYRLSPVPG R QKMSLTLFMK GL + V + PRKL ГПГ В.А. ++
Sbjct: 1 MEALPILSALFAATSVYLFWFYLLARKLTGPSVWPVVGSLPLLYSNRKQIHDWITSNLRATGGSATYQTCTLALPFVARKQGLYTVTSNPKNIEHILRTRFDNYPKGPTWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAERDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFAKAFDNATEATLQRLLYPAFLWRIQKFFGLGAERQLEKSLKVVGDYMNDAVAARKLTPSDDLISRFMNKRDVDGNPFPSAVLQRIALNFVLAGRDTSSVALSWFFHLIMENPHIEEKIIAEISTVLKQTRGDDPRLWTEEPLAFDEADKLVYLKAALAETLRLYPSVPEDFKYVVKDDVLPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPERWISAEGNRFEPPKNGYKFVAFNGGPRTCLGKDLAYLQMKSVVSAVLLRYRLSPVPGFRAQQKMSLTLFMKKGLQVHLHPRKLGGGPGHVAATS 521 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с ExPASy TrEMBL
Соответствие: A0A540LZF9_MALBA (неохарактеризованный белок OS = Malus baccata OX = 106549 GN = C1h56_022716 PE = 3 SV = 1)

HSP 1 Оценка : 908,672 бит (2347), Expect = 0,000e + 0
Identity (435/521) 83,49%), положительные = 477/521 (91,55%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL-DGPGLVATSA 520
            ME L + FL А. А. SVY FWFYLLARKLTGP VWPVVGS + Р + LF НаРа + IHDWI + NLRATGGS + TYQTCT + ALPFLAR + QG + FTVTC + PKNIEHILRTRFDNYPKGP ++ QAAFHDLLGEGIFNSDGETWL QRKTAALEFTTRTLRQAMARWVNRTIR RLWCILDKA ++ DH VDLQDLLLRLTFDNICGLTFGKDPETLSP + LPDNPFSKAFDNATEATL + RLLYPSF + W ++ QF LGAE + QL ++ SL ВВГ + YM ++ AVAARK PSDDLISRFMNKRD + DGNPFPS + VLQRIALNFVLAGRDTSSVALSWFF LVM NP + И.Е. + И.В. ЭИ ++ В.Л. + ТРГ DP + ЛЖИ + EPLVFDEADKLVYLKAAL + ETLRLYPSVP DFKYVVNDD + LPDGTFVP + GSTVTYSIYSVGRMK IWGEDCMEFKPDRW + S + D + FEPPKD YKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLS ВПГ R QKMSLTLFMK GL + В.Я. PRKL GP V + A
Sbjct: 1 MEALPIFSALFAAASVYLFWFYLLARKLTGPSVWPVVGSIPFLFSNRNQIHDWITNNLRATGGSATYQTCTLALPFLARRQGLFTVTCNPKNIEHILRTRFDNYPKGPTYQAAFHDLLGEGIFNSDGETWLTQRKTAALEFTTRTLRQAMARWVNRTIRIRLWCILDKAARDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELPDNPFSKAFDNATEATLKRLLYPSFLWRIQKLFGLGAERQLEKSLEVVGDYMNDAVAARKLTPSDDLISRFMNKRDIDGNPFPSAVLQRIALNFVLAGRDTSSVALSWFFHLVMENPQIEEKIVAEISTVLKQTRGDDPRLWVKEPLVFDEADKLVYLKAALSETLRLYPSVPEDFKYVVNDDILPDGTFVPAGSTVTYSIYSVGRMKNIWGEDCMEFKPDRWISAD-GKFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGFRAQQKMSLTLFMKNGLQVYLHPRKLGGGPDQVTQAA 520 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с ExPASy TrEMBL
Соответствие: A0A498K7L7_MALDO (неохарактеризованный белок OS = Malus domestica OX = 3750 GN = DVh34_038514 PE = 3 SV = 1)

HSP 1 Оценка: 905,205 бит (2338), Expect = 0,000e + 0
Identity = 434/521 83,30%), положительные результаты = 477/521 (91,55%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL-DGPGLVATSA 520
            ME L + FL А.А. SVY FWFYLLARKLTGP VWPVVGS + Р + LF NR + IHDWI + NLRATGGS + TYQTCT + ALPFLAR + QG + FTVTC + PKNIEHILRTRFDNYPKGP ++ QAAFHDLLGEGIFNSDGETWL QRKTAALEFTTRTLRQAMARWVNRTIRNRLW ILDKA ++ DH VDLQDLLLRLTFDNICGLTFGKDPETLSP + LPDNPFSKAFDNATEATL + RLLYPSF + W ++ QF LGAE + QL ++ SL ВВГ + YM ++ AVAARK PSDDLISRFMNKRD + DGNPFPS + VLQRIALNFVLAGRDTSSVALSWFF LVM NP + И. Е. + И.В. ЭИ ++ В.Л. + ТРГ DP + ЛЖИ + EPLVFDEADKLVYLKAAL + ETLRLYPSVP DFKYVVNDD + LPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKPDRW + S + D + FEPPKD YKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLS ВПГ R QKMSLTLFMK GL + В.Я. ПРКЛ ГП В + А
Sbjct: 1 MEALPIFSALFAAASVYLFWFYLLARKLTGPSVWPVVGSIPFLFSNRKQIHDWITNNLRATGGSATYQTCTLALPFLARRQGLFTVTCNPKNIEHILRTRFDNYPKGPTYQAAFHDLLGEGIFNSDGETWLTQRKTAALEFTTRTLRQAMARWVNRTIRNRLWFILDKAARDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELPDNPFSKAFDNATEATLKRLLYPSFLWRIQKLFGLGAERQLEKSLEVVGDYMNDAVAARKLTPSDDLISRFMNKRDIDGNPFPSAVLQRIALNFVLAGRDTSSVALSWFFHLVMENPQIEEKIVAEISTVLKQTRGDDPRLWVKEPLVFDEADKLVYLKAALSETLRLYPSVPEDFKYVVNDDILPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPDRWISAD-GKFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGFRAQQKMSLTLFMKDGLQVYLHPRKLGGGPDQVTQAA 520 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с ExPASy TrEMBL
Соответствие: A0A5N5GTI7_9ROSA (Cytochrome P450 86A1 OS = Pyrus ussuriensis x Pyrus communis OX = 2448454 GN = D8674_023088 PE = 3 SV = 1)

HSP 1 Оценка: 901,738 бит (2329,000), ожидаемое значение = 0 = 900 433/521 (83,11%), положительные = 474/521 (90,98%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLD-GPGLVATSA 520
            METL + FL А. А. В.Я. FWFYLLARKLTGP VWPVVGS + Р + LF NR + IHDWI SNLRATGGS + TYQTCT + ALPF + ARKQG + FTVTC + PKNIEHILRTRFDNYPKGP ++ QAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKA ++ DH VDLQDLLLRLTFDNICGLTFGKDPETLSP + LPDNPFSKAFDNATEATL + RLLYPSF + W ++ Q LGAE + QL ++ SL ВВГ + Ю.М. ++ АВА РК PSDDLISRFMNKRDVDGN FPS + VLQRIALNFVLAGRDTSSVALSWFF LVM NP + И.Е. + И.В. ЭИ ++ В.Л. + ТРГ DP + ЛЖИ + EPLVFDEADKLVYLKAAL + ETLRLYPSVP DFKYVVNDD + LPDGTFVP + GSTVTYSIYSVGRMK + IWGEDCMEFKPDRW + S + D + FEPPKD YKF + AFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLS ВПГ R QKMSLTLFMK GL + В.Я. ФРК Г.П. VA
Sbjct: 1 METLPIFSALFAAAFVYLFWFYLLARKLTGPSVWPVVGSIPFLFSNRKQIHDWITSNLRATGGSATYQTCTLALPFVARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTYQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKAARDHIAVDLQDLLLRLTFDNICGLTFGKDPETLSPELPDNPFSKAFDNATEATLKRLLYPSFLWRIQKLLGLGAERQLEKSLKVVGDYMNDAVALRKLTPSDDLISRFMNKRDVDGNQFPSAVLQRIALNFVLAGRDTSSVALSWFFHLVMENPQIEEKIVAEISTVLKQTRGDDPRLWVKEPLVFDEADKLVYLKAALSETLRLYPSVPEDFKYVVNDDILPDGTFVPAGSTVTYSIYSVGRMKSIWGEDCMEFKPDRWISAD-GKFEPPKDGYKFMAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSLVPGFRAQQKMSLTLFMKNGLQVYLHPRKFGRGPDQVTQVA 520 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с ExPASy TrEMBL
Соответствие: A0A2I4DHV3_JUGRE (цитохром P450 86A1 OS = Juglans regia OX = 51240 GN = LOC108980314 PE = 3 SV = 1)

HSP 1 Оценка : 900,968 бит (2327), Expect = 0,000e + 0 9006/ Identity = (83,20%), положительные = 468/512 (91,41%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLDG 512
            METL + F + AAA SY FWFYLLA + KLTGPKVWPVVGSLP LF NR + RIHDW + ASNLRATGGS + TYQTCT + PFLA KQG FTVTCHPKNIEH + LRTRF + NYPKGP WQAAFHDLLG + GIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIR RLW ILDKA + KD + T VDLQDLLLRLTFDNICGLTFGKDPETLS DLP + НРП + AFD ATEATLQRLLYP F + W + F + G E ++ LK С.  Л. В. NYM ++, А + AARK PSDDL + SRFMNKRDVDGNPFP SVLQRIALNFVLAGRDTSSVALSWFFWLVM ++ PE + Е + Ni + EI ++ В.Л. ETRG D + W + EEPLVFDEAD + LVYLKAALAETLRLYPSVP DFKYVV + DDVLPDGTFVP + GSTVTYSIYSVGRMKTIWGEDCMEFKP + RWLS ++ RFEPPKD YKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRV QKMSLTLFMK GL + В.Я. + PR + Л.Г.
Sbjct: 1 METLPILFGIAAAASAYLFWFYLLAQKLTGPKVWPVVGSLPALFLNRSRIHDWMASNLRATGGSATYQTCTMPFPFLASKQGFFTVTCHPKNIEHVLRTRFENYPKGPDWQAAFHDLLGQGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRTRLWYILDKAAKDNTSVDLQDLLLRLTFDNICGLTFGKDPETLSLDLPNNPFAIAFDTATEATLQRLLYPGFLWRFEKVFCIGTERRLKESLQVVENYMNDAIAARKESPSDDLLSRFMNKRDVDGNPFPMSVLQRIALNFVLAGRDTSSVALSWFFWLVMHHPEVEENIIKEISTVLKETRGDDHRKWIEEPLVFDEADRLVYLKAALAETLRLYPSVPEDFKYVVSDDVLPDGTFVPAGSTVTYSIYSVGRMKTIWGEDCMEFKPERWLSAEGDRFEPPKDGYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVEQKMSLTLFMKNGLRVYLRPRQLQG 512 
ВЗРЫВ ЭВМ.model.ctg8.22 в сравнении с ExPASy Swiss-Prot
Соответствие: C86A1_ARATH (Cytochrome P450 86A1 OS = Arabidopsis thaliana OX = 3702 GN = CYP86A1 PE = 1 SV = 2)

HSP 1 Оценка: 822,387 бит (2123), Expect = 0,000e + 0
Identity = 392/510 (76,86%), положительные результаты = 440/510 (86,27%), кадр запроса = 0

Запрос: 1 METLTLFFT - LAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPR 508
            ME LT AA SVY WFY L + R + LTGPKV P VGSLP L NR + RIHDWIA NLRATGG TYQTCT + + PF + A + QG + TVTCHPKN + EHIL + TRFDNYPKGP W + AAFHDLLG + GIFNSDG + TWL + QRKTAALDPLDDNGT + QWLDDNGL + QRKTAALEFTARTLVL + NLPLWL + NLPDDNG + NLPLWLD + NGTLDPL + NLPWLD + NLPDNLD + NGTLD + NRLWLD + NGTLD + NGTLD + NGLWLD + NRLWLDLD + NGTL + AFD ATEATL + RLLY F + W ++ QA + G + E + LK + SL VV YM ++ A + ARK PSDDL + SRF + KRDV + GN P + VLQRIALNFVLAGRDTSSVALSWFFWLVMNN E + E IVNE ++ VL ETRG D + LV EEPLYVLIYP + W EEPLYVLIYP + W EEPLYVLIYP GRMKTIWGEDC + EF + P + RWL ++ D RFE PKD YKFVAFNAGPRTCLGKDLAY QMKSVASAVLLRYR + PVPGHRV QKMSLTLFMK GL + VY QPR
Sbjct: 1 MEALNSILTGYAVAALSVYALWFYFLSRRLTGPKVLPFVGSLPYLIANRSRIHDWIADNLRATGG - TYQTCTMVIPFVAKAQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNSDGDTWLMQRKTAALEFTTRTLRQAMARWVNGTIKNRLWLILDRAVQNNKPVDLQDLFLRLTFDNICGLTFGKDPETLSLDLPDNPFSVAFDTATEATLKRLLYTGFLWRIQKAMGIGSEDKLKKSLEVVETYMNDAIDARKNSPSDDLLSRFLKKRDVNGNVLPTDVLQRIALNFVLAGRDTSSVALSWFFWLVMNNREVETKIVNELSMVLKETRGNDQEKWTEEPLEFDEADRLVYLKAALAETLRLYPSVPQDFKYVVDDDVLPDGTFVPRGSTVTYSIYSIGRMKTIWGEDCLEFRPERWLTADGERFETPKDGYKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRVFPVPGHRVEQKMSLTLFMKNGLRVYLQPR 508 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с ExPASy Swiss-Prot
Соответствие: 86A22_PETHY (Cytochrome P450 86A22 OS = Petunia hybrida OX = 4102 GN = CYP86A22 PE = 1 SV = 1)

HSP 1 Оценка : 681,789 бит (1758), Expect = 0,000e + 0
Identity = 331/513 (64,52%), положительные результаты = 393/513 (76,61%), кадр запроса = 0

Запрос: 10 LAAATSVYCFWFYLLARKLTGPK --- VWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKAR --------- PSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL 510
            + A + Y WF + + + GPK + WPVVGSLP LN NR + H + WIA NLRA G TYQTC A + PFLARKQ + TVTC PKN + EHIL + RFDNYPKGP + WQA FHDLLGEGIFNSDG + TWL QRKTAALEFTTRTLRQAM RWVDPG + PVFTLRQAM RWVDPG I + NL ATEATL R + P FVWKL + LG EL SL V NYM + + RK DDL + SRFM K ++ + F LQ + ALNF + LAGRDTSSVALSWFFWLV + NP + E + I + EI ++ L + ETRG D W + EEPLVF + E D + L + YLKAAL + ETLRLYPSVP D + V ++ DD LPDGTFVP + GS + TYSIYS GRMK IWGEDC + EFKP + RW + SD + F + + D +++ FVAFNAGPR CLGKDLAYLQMKS + A + AVLLR + RL + PGH + V QKMSLTLFMK GL + PR L
Sbjct: 9 IVAIVAAYLLWFKSITKSMKGPKGPTMWPVVGSLPGLIENGNRMHEWIADNLRACSG - TYQTCICAIPFLARKQ-LVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGEGIFNSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRAIKNRFCPILEMAQVQGKPVDLQDLLLRLTFDNICGLAFGKDPETLSPELPENNFATSFDRATEATLHRFIMPEFVWKLKKMLGLGLEVSLNNSLKQVDNYMTDVINTRKLELLNHQNGGPQHDDLLSRFMKKKESYSDKF ---- LQHVALNFILAGRDTSSVALSWFFWLVSSNPRVEEKILVEICTILAETRGNDTSKWLEEPLVFEEVDQLMYLKAALSETLRLYPSVPEDSKHVISDDYLPDGTFVPAGSNITYSIYSTGRMKFIWGEDCLEFKPERWMSQDGDKFQ-VQDTFRFVAFNAGPRICLGKDLAYLQMKSIAAAVLLRHRLAVAPGHKVEQKMSLTLFMKDGLVMNVTPRDL 513 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с ExPASy Swiss-Prot
Соответствие: C86A2_ARATH (Cytochrome P450 86A2 OS = Arabidopsis thaliana OX = 3702 GN = CYP86A2 PE = 1 SV = 1)

HSP 1 Оценка: 678,322 бит (1749), Expect = 0,000e + 0
Identity = 326/512 (63,67%), положительные результаты = 388/512 (75,78%), кадр запроса = 0

Запрос: 10 LAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARK ---------- ARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLD 511
            LA + Y WF ++ RL GP + VWPV + GSLP L R + R + HDWI NLRA GG TYQTC A + PFLA + KQG + TVTC PKNIEH + L + TRFDNYPKGP + WQA FHD LG + GIFNSDG + TWL QRKTAALEFTTRTLRQAM RWVDL ++ I + PV LRLTFDNICGL FGKD T + P LP + N F + AFD ATEA + LQR + P F + W + L + LG EL RSL + Y + D + RK + DDL + SRFM K + D + + L + + ALNF + LAGRDTSSVALSWFFWL + + P + ED IV EI SVL ETRG DW EPL FDE D + LVYLKAAL + ETLRLYPSVP D K + VVNDD + LPDGTFVP + GS + VTYSIY + GRMK + WGEDC + EFKP + RW + SD + FD Y + FVAFNAGPR CLGKDLAYLQMK ++ A + GLMSLT + LFK
Sbjct: 9 LVAVVAAYWLWFQRISRWLKGPRVWPVLGSLPGLIEQRDRMHDWITENLRACGG - TYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIFNSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRGIKLRFCPILETAQNNYEPVDLQDLILRLTFDNICGLAFGKDTRTCAPGLPENGFASAFDRATEASLQRFILPEFLWRLKKWLGLGLEVSLSRSLGEIDGYLDAVINTRKQELLSQRESGVQRHDDLLSRFMKKKD --- QSYSETFLRHVALNFILAGRDTSSVALSWFFWLITTHPTVEDKIVREICSVLIETRGTDVSSWTAEPLEFDEVDRLVYLKAALSETLRLYPSVPEDSKHVVNDDILPDGTFVPAGSSVTYSIYAAGRMKSTWGEDCLEFKPERWISPDDGKF-VNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKMSLTLFMKNGLLVNVHKRDLE 514 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с ExPASy Swiss-Prot
Соответствие: C86A7_ARATH (Cytochrome P450 86A7 OS = Arabidopsis thaliana OX = 3702 GN = CYP86A7 PE = 2 SV = 1)

HSP 1 Оценка: 670,618 бит (1729), Expect = 0,000e + 0
Identity = 324/506 (64,03%), положительные результаты = 385/506 (76,09%), кадр запроса = 0

Запрос: 17 YCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKAR --------- PSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLDGP 513
            Y WF LR GP + VWP + VGSLP L TN + R + HD + IA NLR GG TYQTC + PFLA + KQG TVTC PKN + EHIL + TRFDNYPKGPSWQ + FHDLLG + GIFNSDG + TW QRKTAALEFTTRTLRQAMARWV + R ISPL + NRLDP ILF + A N F + AFD ATEATLQR + P F + WK ++ LG E + RS ++ V NY + E + RK DDL + SRFM K ++ + L + + ALNF + LAGRDTSSVA + SWFFWLV NP + E + I + NEI ++ L + TR + W + EPL FDE D + LVYLKAAL + ETLRLYPSVP D K + VV + DVLPDGTFVPSGS VTYSIYSVGRMK IWGEDC + EFKP + RWL R + + YKFVAFNAGPR CLGKDLAYLQMKS + +++ LLR + RL + PGHRV QKMSLTLFMK + GLK + RWL
Sbjct: 16 YIIWFVSLRRSYKGPRVWPLVGSLPALITNAHRMHDFIADNLRMCGG - TYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDGIFNSDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESARSRAEPIDLQDVLLRLTFDNICGLTFGKDPRTLSPEFPENGFAVAFDGATEATLQRFIMPEFIWKIRKWLRLGLEDDMSRSISHVDNYLSEIINTRKLELLGQQQDESRHDDLLSRFMKKKE ---- SYSDKYLKYVALNFILAGRDTSSVAMSWFFWLVSLNPRVEEKIINEICTILIKTRDTNVSKWTDEPLTFDEIDQLVYLKAALSETLRLYPSVPEDSKFVVANDVLPDGTFVPSGSNVTYSIYSVGRMKFIWGEDCLEFKPERWLEESR --- DEKCNQYKFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTVAPGHRVEQKMSLTLFMKFGLKMDVHKRDLTLP 512 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с ExPASy Swiss-Prot
Соответствие: C86A8_ARATH (Cytochrome P450 86A8 OS = Arabidopsis thaliana OX = 3702 GN = CYP86A8 PE = 2 SV = 1)

HSP 1 Оценка: 670,233 бит (1728), Expect = 0,000e + 0
Identity = 331/520 (63,65%), положительные результаты = 389/520 (74,81%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARK --------- ARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLS-SDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL 510
            ME T L + A T + YW ++ RL GP + VWP ++ GSLP LN R + HDWI + NLRA G TYQTC A + PFLA + KQG + TVTC P + N + EHIL + RFDNYPKGP + WQA FHDLLG + GIFNSDG + TWL QRKTAALEFT AEXTLRRLI + RFLQDNGTRTLRQAMARWDDNG T + P LP N F + AFD ATEA + LQR + P + WK + LG EL RSL V NY + E + RK + DDL + SRF + K ++ + LQR + ALNF + LAGRDTSSVALSWFFWL + + P IED I + EI + VL ETRG D LW + EPL + E D + LV + LKAAL + ETLRLYPSVP DKV DDVLPDGTFVP + GS ++ TYSIYS GRMK + WGEDC + EFKP + RW + S SD RF D + KFVAFNAGPR CLGKDLAYLQMKS + ASAVLLR + VL + V GH + V QKMSLTLFM
Sbjct: 1 MEISTALMILSAITA-YFLWLTFISRCLKGPRVWPILGSLPGLIENCERMHDWISDNLRACSG - TYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKNRFDNYPKGPTWQAVFHDLLGQGIFNSDGDTWLFQRKTAALEFTTRTLRQAMARWVNRAIKLRFLPILENARLGSEPIDLQDLLLRLTFDNICGLTFGKDPRTCAPGLPVNTFAVAFDRATEASLQRFILPEILWKFKRWLRLGLEVSLTRSLVQVDNYLSEIITTRKEEMMTQHNNGKHHDDLLSRFIKKKE ---- SYSDETLQRVALNFILAGRDTSSVALSWFFWLITQHPAIEDKILREICTVLVETRGDDVALWTDEPLSCEELDRLVFLKAALSETLRLYPSVPEDSKRAVKDDVLPDGTFVPAGSSITYSIYSAGRMKSTWGEDCLEFKPERWISQSDGGRF-INHDPFKFVAFNAGPRICLGKDLAYLQMKSIASAVLLRHRLTVVTGHKVEQKMSLTLFMKYGLLVNVHERDL 512 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с ExPASy Swiss-Prot
Соответствие: C86A4_ARATH (Cytochrome P450 86A4 OS = Arabidopsis thaliana OX = 3702 GN = CYP86A4 PE = 1 SV = 1)

HSP 1 Оценка: 659,062 бит (1699), Expect = 0,000e + 0
Identity = 323/515 (62,72%), положительные результаты = 384/515 (74,56%), кадр запроса = 0

Запрос: 10 LAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKA ----------- RPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDP-KLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLDG 512
            LA + Y WF ++ RL GP + VWP ++ GSLP L R + R + H + WI NLRA GG TYQTC A + PFLA + KQG + TVTC PKN + EH + L + TRFDNYPKGP + WQ + FHDLLG + GIFNSDG + TWL QRKTAALEFTTRTLRQAM RWVNR + PVDLQDL + LRLTFDNICGL FGKD T + P LP + N F + AFD ATEA + LQR + P F + WKL + LG EL RSL + Y + + RK + DDL + SRFM K + + + LQ + ALNF + LAGRDTSVALSWFFWL + + P + ED IV EI SVL E FDE D + LVYLKAA ++ ETLRLYPSVP D K + V NDDVLPDGTFVP + GS + VTYSIY + GRMK + WGEDC + EF P + RW + S + FD Y + FVAFNAGPR CLGKDLAYLQMK ++ A + AVLLR + RL + GLMGHL VFRL + V QF
Sbjct: 9 LVAIVTGYWLWFKRISRWLKGPRVWPLLGSLPGLIEQRDRMHEWITENLRACGG - TYQTCIFAVPFLAKKQGLVTVTCDPKNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIFNSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRGIKLRFCPILATAQDNAEPVDLQDLILRLTFDNICGLAFGKDTRTCAPGLPENGFASAFDRATEASLQRFIIPKFMWKLKKWLGLGLEVSLSRSLGEIDEYLAAVINTRKQELMSQQESGTHQRHDDLLSRFMMKKT --- ESYSDTFLQHVALNFILAGRDTSSVALSWFFWLITMHPTVEDKIVREICSVLIETRGTDDVASWTEEPLGFDEIDRLVYLKAAISETLRLYPSVPEDSKHVENDDVLPDGTFVPAGSSVTYSIYAAGRMKSTWGEDCLEFNPERWISPIDGKF-INHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKVEQKMSLTLFMKNGLLVNLYKRDLQG 517 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с ExPASy Swiss-Prot
Соответствие: C86B1_ARATH (Cytochrome P450 86B1 OS = Arabidopsis thaliana OX = 3702 GN = CYP86B1 PE = 2 SV = 1)

HSP 1 Оценка: 445,277 бит (1144), Expect = 1,733e-150
Идентичность = 229/505 (45,35%), положительные результаты = 315/505 (62,38%), кадр запроса = 0

Запрос: 10 LAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVL-FTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPS -------- DDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSE - TRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKV 503
            LA V + L + KG VWP + G LP LFR I ++ W ++ L G + ++ P + + T + TC P + N + EH + L + RF + PKG ++ DLLG + GIFN + D ETW QRKTA ++ EF + RQ + + + RL + L + + K + P + DLQD + LLRLTFDN + C + FG DP L PD P PF + KAF ++ ATEA + R + P + VWK D + G EK + LK S + V ++ DE + RK S DL ++ FM RD GF L + I + NF + LAGRDTSSVALSWFFWL + NPE + E + I + E + + L + GKE + E K + YL + AAL + E LRLYPSVP + DKV DDV PDGT + GV Y + IY ++ GRM + IWG + DC + EF + P + RWL RE + YKF AFN GPR CLGKD QMKS A + A ++ RY ++ V GH + V K ++ LT ++ MK + GL V
Sbjct: 41 LLIAIFVFVAIHALRQKKYQGLPVWPFLGMLPSLAFGLRGNIYEWLSDVLCLQNGTFQFRG ----- PWFSSLNS - TITCDPRNVEHLLKNRFSVFPKGSYFRDNLRDLLGDGIFNADDETWQRQRKTASIEFHSAKFRQLTTQSLFELVHKRLLPVLETSVKSSSPIDLQDVLLRLTFDNVCMIAFGVDPGCLGPDQPVIPFAKAFEDATEAAVVRFVMPTCVWKFMRYLDIGTEKKLKESIKGVDDFADEVIRTRKKELSLEGETTKRSDLLTVFMGLRDEKGESFSDKFLRDICVNFILAGRDTSSVALSWFFWLLEKNPEVEEKIMVEMCKILRQRDDHGNAEKSDYEPVFGPEEIKKMDYLQAALSEALRLYPSVPVDHKEVQEDDVFPDGTMLKKGDKVIYAIYAMGRMEAIWGKDCLEFRPERWLRDGRFMSE --- SAYKFTAFNGGPRLCLGKDFAYYQMKSTAAAIVYRYKVKVVNGHKVEPKLALTMYMKHGLMV 535 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с ExPASy Swiss-Prot
Соответствие: C94A2_VICSA (Cytochrome P450 94A2 OS = Vicia sativa OX = 3908 GN = CYP94A2 PE = 2 SV = 1)

HSP 1 Оценка: 353,214 бит (905), Expect = 3,949e-115
Identity = 215/542 (39,67%), положительные результаты = 304/542 (56,09%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTG -------------- PKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRL - LYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAV ---------- AARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPK ------ DSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSP - VPGHRVVQKMSLTLFMKYGLKVYFQPR 508
            ME TL L + TS + FWF LA K PK + P + GS LN + RW S ++ T SST + + PF AR + TP ++ HILRT FY KG ++ + + D LG + GIFN + DGE + W QR + ++ EF TR + LR + + V + + + RL + L + AS T + D QD + L RLTFDNIC + FG DPE LP LP + PF + KAFD +++ +++ RL LP + WK ++ ++ G E + QLK ++ AV + VA + S DL + SRF ++ DS + + + + + LAGRDT + S AL + WFFWL + + + E + I + EIT SET G + DE + VY AAL E ++ RLYP + P + DK V + DDVLPDGT VG VTY IY ++ GR + IWG D EF + P + RWLS DEKDY + F AGPR C + GK ++ A + LQMK V + ++ R + R + PVGT MK GV + R
Sbjct: 1 MELETLISWLLFSTSL - FWFLFLATKTKSKPPKTPSSTTNTPIPKSYPIFGSAFSLLANFHRRIQW-TSDILQTIPSSTF --- VLHRPFGARQ ---- VFTAQPAVVQHILRTNFTCYGKGLTFYQSINDFLGDGIFNADGESWKFQRQISSHEFNTRSLRKFVETVVDVELSDRLVPVLSQASNSQTTLDFQDILQRLTFDNICMIAFGYDPEYLLPSLPEIPFAKAFDESSQLSIERLNALIP-LLWKVKRFLNIGVERQLKEAVAEVRGLATKIVKNKKKELKEKALQSESESVDLLSRFLSSGHSD ----- ESFVTDMVISIILAGRDTTSAALTWFFWLLSKHSHVENEILKEITGK-SETVG ------------ YDEVKDMVYTHAALCESMRLYPPLPVDTKVAVHDDVLPDGTLVKKGWRVTYHIYAMGRSEKIWGPDWAEFRPERWLSRD ---- EVGKWSFVGIDYYSYPVFQAGPRVCIGKEMAFLQMKRVVAGIMGRFRVVPAMVEGIEPEYTAHFTSVMKGGFPVKIEKR 509 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с ExPASy Swiss-Prot
Соответствие: C94A1_VICSA (Cytochrome P450 94A1 OS = Vicia sativa OX = 3908 GN = CYP94A1 PE = 2 SV = 2)

HSP 1 Оценка: 348,977 бит (894), Expect = 1,397e-113
Identity = 182/496 (36,69%), положительные результаты = 296/496 (59,68%), кадр запроса = 0

Запрос: 28 LTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYP-SFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARK ------- ARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFE --- PPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLF ---- MKYGLKVYFQPR 508
            + T PK + P ++ GS N + R W + S ++ S + T + QL ++ Q + T + P ++ HIL + + F NY KG ++ D LG GIFN ++ GW QR + A + EF T +++ R + V + + NRL IL +++ + + D QD + LR TFDNIC + FG DPE L + P + F ++ A +++ ATE + + RP + WK ++ F ++ G + EK + LK ++ V ++ + V + K + ++ D ++ SRF ++ D + + I ++ F + LAG + DT + S AL + WFFWL + NP + E + IVNE ++ E + V + DE ++ VY AAL + E ++ RLYP VP + DK VNDDVLPDG V G + VTY + Y ++ GRMK ++ WG + D EF + P + RWL D + + DSY + F AGPR CLGK ++ A ++ QMK + + ++ ++++ VP + Q + F M + GVQR
Sbjct: 45 ITLPKSYPLIGSYLSFRKNLHRRIQWL-SDIVQISPSATFQLDGT ---- LGKRQ --- IITGNPSTVQHILKNQFSNYQKGTTFTNTLSDFLGTGIFNTNGPNWKFQRQVASHEFNTKSIRNFVEHIVDTELTNRLIPILTSSTQTNNILDFQDILQRFTFDNICNIAFGYDPEYLTPSTNRSKFAEAYEDATEISSKRFRLPLPIIWKIKKYFNIGSEKRLKEAVTEVRSFAKKLVREKKRELEEKSSLETEDMLSRFLSSGHSDED ----- FVADIVISFILAGKDTTSAALTWFFWLLWKNPRVEEEIVNELSK ------------- KSELMVYDEVKEMVYTHAALSESMRLYPPVPMDSKEAVNDDVLPDGWVVKKGTIVTYHVYAMGRMKSLWGDDWAEFRPERWLEKDEVNGKWVFVGRDSYSYPVFQAGPRVCLGKEMAFMQMKRIVAGIVGKFKV - VPEAHLAQEPGFISFLSSQMEGGFPVTIQKR 512 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с ExPASy Swiss-Prot
Соответствие: C70B1_ARATH (Cytochrome P450 704B1 OS = Arabidopsis thaliana OX = 3702 GN = CYP704B1 PE = 1 SV = 1)

HSP 1 Оценка : 344,739 бит (883), Expect = 8,346e-112
Identity = 202/5 (37,34%), положительные результаты = 296/541 (54,71%), кадр запроса = 0

Запрос: 4 LTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKA ------------------ RPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSV ----------- LSETRGRDPKLWVEEP ------ LVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLR-YRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPR 508
            ++ L + A + + FR + GPK WP + VG + TN + R + HDW + L + + T + + PF + TP N + E ++ L + TF NYPKG ++ + LLG + GIFNSDGE W QRKTA + EF ++ LR + V + + L + IL + AS VD + Q + LL + R + T D + IC + FG + TL + P + LP + N F + KAFD AR + P + WK ++ ++ G + EL + S + VV ++ + RKA + D ++ SRF + D + L + I LNFV + AGRDT ++ L + W +++ MN + + + + E + + L + D + E + L + D KL YL A + ETLRLYP + VP DK V + DD + LP + GT V + G VTY YS + GRM + WG D FKP + RWL + P + KF AF AGPR CLGKD AYLQMK + A A + LR Y + VP HV + MLM + GLKV R
Sbjct: 1 MSLCLVIACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNS ------ RTVVVPMPFTT ----- YTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRKTASFEFASKNLRD-FSTVVFKEYSLKLFTILSQASFKEQQVDMQELLMRMTLDSICKVGFGVEIGTLAPELPENHFAKAFDTANIIVTLRFIDP - LWKMKKFLNIGSEALLGKSIKVVNDFTYSVIRRRKAELLEAQISPTNNNNNNNNKVKHDILSRFIEISDDPDSKETEKSLRDIVLNFVIAGRDTTATTLTWAIYMIMMNENVAEKLYSELQELEKESAEATNTSLHQYDTEDFNSFNEKVTEFAGLLNYDSLGKLHYLHAVITETLRLYPAVPQDPKGVLEDDMLPNGTKVKAGGMVTYVPYSMGRMEYNWGSDAALFKPERWLKDGVFQNASP --- FKFTAFQAGPRICLGKDSAYLQMK-MAMAILCRFYKFHLVPNHPVKYRMMTILSMAHGLKVTVSRR 523 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с Araport11
Соответствие: AT5G58860.1 (| цитохром P450% 2C семейство 86% 2C подсемейство A% 2C полипептид 1 | Chr5: 23765999-23767997 ОБРАТНАЯ ДЛИНА = 513 | 201606)

HSP 1 Оценка: 822,387 бит (2123), ожидаемое значение 0,000e + 0
Идентичность = 392/510 (76,86%), Положительные = 440/510 (86,27%), Кадр запроса = 0

Запрос: 1 METLTLFFT - LAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPR 508
            ME LT AA SVY WFY L + R + LTGPKV P VGSLP L NR + RIHDWIA NLRATGG TYQTCT + + PF + A + QG + TVTCHPKN + EHIL + TRFDNYPKGP W + AAFHDLLG + GIFNSDG + TWL + QRKTAALDPLDDNGT + QWLDDNGL + QRKTAALEFTARTLVL + NLPLWL + NLPDDNG + NLPLWLD + NGTLDPL + NLPWLD + NLPDNLD + NGTLD + NRLWLD + NGTLD + NGTLD + NGLWLD + NRLWLDLD + NGTL + AFD ATEATL + RLLY F + W ++ QA + G + E + LK + SL VV YM ++ A + ARK PSDDL + SRF + KRDV + GN P + VLQRIALNFVLAGRDTSSVALSWFFWLVMNN E + E IVNE ++ VL ETRG D + LV EEPLYVLIYP + W EEPLYVLIYP + W EEPLYVLIYP GRMKTIWGEDC + EF + P + RWL ++ D RFE PKD YKFVAFNAGPRTCLGKDLAY QMKSVASAVLLRYR + PVPGHRV QKMSLTLFMK GL + VY QPR
Sbjct: 1 MEALNSILTGYAVAALSVYALWFYFLSRRLTGPKVLPFVGSLPYLIANRSRIHDWIADNLRATGG - TYQTCTMVIPFVAKAQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNSDGDTWLMQRKTAALEFTTRTLRQAMARWVNGTIKNRLWLILDRAVQNNKPVDLQDLFLRLTFDNICGLTFGKDPETLSLDLPDNPFSVAFDTATEATLKRLLYTGFLWRIQKAMGIGSEDKLKKSLEVVETYMNDAIDARKNSPSDDLLSRFLKKRDVNGNVLPTDVLQRIALNFVLAGRDTSSVALSWFFWLVMNNREVETKIVNELSMVLKETRGNDQEKWTEEPLEFDEADRLVYLKAALAETLRLYPSVPQDFKYVVDDDVLPDGTFVPRGSTVTYSIYSIGRMKTIWGEDCLEFRPERWLTADGERFETPKDGYKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRVFPVPGHRVEQKMSLTLFMKNGLRVYLQPR 508 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с Araport11
Соответствие: AT4G00360.1 (| цитохром P450% 2C семейство 86% 2C подсемейство A% 2C полипептид 2 | Chr4: 160951-162778 ДЛИНА ПЕРЕДАЧИ = 553 | 201606)

HSP 1 Оценка: 678,322 бит (1749), ожидание = 0,000e + 0
Идентичность = 326/512 (63,67%), положительные результаты = 388/512 (75,78%), кадр запроса = 0

Запрос: 10 LAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARK ---------- ARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLD 511
            LA + Y WF ++ RL GP + VWPV + GSLP L R + R + HDWI NLRA GG TYQTC A + PFLA + KQG + TVTC PKNIEH + L + TRFDNYPKGP + WQA FHD LG + GIFNSDG + TWL QRKTAALEFTTRTLRQAM RWVDL ++ I + PV LRLTFDNICGL FGKD T + P LP + N F + AFD ATEA + LQR + P F + W + L + LG EL RSL + Y + D + RK + DDL + SRFM K + D + + L + + ALNF + LAGRDTSSVALSWFFWL + + P + ED IV EI SVL ETRG DW EPL FDE D + LVYLKAAL + ETLRLYPSVP D K + VVNDD + LPDGTFVP + GS + VTYSIY + GRMK + WGEDC + EFKP + RW + SD + FD Y + FVAFNAGPR CLGKDLAYLQMK ++ A + GLMSLT + LFK
Sbjct: 9 LVAVVAAYWLWFQRISRWLKGPRVWPVLGSLPGLIEQRDRMHDWITENLRACGG - TYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIFNSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRGIKLRFCPILETAQNNYEPVDLQDLILRLTFDNICGLAFGKDTRTCAPGLPENGFASAFDRATEASLQRFILPEFLWRLKKWLGLGLEVSLSRSLGEIDGYLDAVINTRKQELLSQRESGVQRHDDLLSRFMKKKD --- QSYSETFLRHVALNFILAGRDTSSVALSWFFWLITTHPTVEDKIVREICSVLIETRGTDVSSWTAEPLEFDEVDRLVYLKAALSETLRLYPSVPEDSKHVVNDDILPDGTFVPAGSSVTYSIYAAGRMKSTWGEDCLEFKPERWISPDDGKF-VNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKMSLTLFMKNGLLVNVHKRDLE 514 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с Araport11
Соответствие: AT1G63710.1 (| цитохром P450% 2C семейство 86% 2C подсемейство A% 2C полипептид 7 | Chr1: 23632360-23633931 ОБРАТНАЯ ДЛИНА = 523 | 201606)

HSP 1 Оценка: 670,618 бит (1729), ожидаемое значение 0,000e + 0
Идентичность = 324/506 (64,03%), Положения = 385/506 (76,09%), Кадр запроса = 0

Запрос: 17 YCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKAR --------- PSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLDGP 513
            Y WF LR GP + VWP + VGSLP L TN + R + HD + IA NLR GG TYQTC + PFLA + KQG TVTC PKN + EHIL + TRFDNYPKGPSWQ + FHDLLG + GIFNSDG + TW QRKTAALEFTTRTLRQAMARWV + R ISPL + NRLDP ILF + A N F + AFD ATEATLQR + P F + WK ++ LG E + RS ++ V NY + E + RK DDL + SRFM K ++ + L + + ALNF + LAGRDTSSVA + SWFFWLV NP + E + I + NEI ++ L + TR + W + EPL FDE D + LVYLKAAL + ETLRLYPSVP D K + VV + DVLPDGTFVPSGS VTYSIYSVGRMK IWGEDC + EFKP + RWL R + + YKFVAFNAGPR CLGKDLAYLQMKS + +++ LLR + RL + PGHRV QKMSLTLFMK + GLK + RWL
Sbjct: 16 YIIWFVSLRRSYKGPRVWPLVGSLPALITNAHRMHDFIADNLRMCGG - TYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDGIFNSDGDTWRFQRKTAALEFTTRTLRQAMARWVDRAIKNRLVPILESARSRAEPIDLQDVLLRLTFDNICGLTFGKDPRTLSPEFPENGFAVAFDGATEATLQRFIMPEFIWKIRKWLRLGLEDDMSRSISHVDNYLSEIINTRKLELLGQQQDESRHDDLLSRFMKKKE ---- SYSDKYLKYVALNFILAGRDTSSVAMSWFFWLVSLNPRVEEKIINEICTILIKTRDTNVSKWTDEPLTFDEIDQLVYLKAALSETLRLYPSVPEDSKFVVANDVLPDGTFVPSGSNVTYSIYSVGRMKFIWGEDCLEFKPERWLEESR --- DEKCNQYKFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTVAPGHRVEQKMSLTLFMKFGLKMDVHKRDLTLP 512 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с Araport11
Соответствие: AT2G45970.1 (| цитохром P450% 2C семейство 86% 2C подсемейство A% 2C полипептид 8 | Chr2: 18912548-18914161 ОБРАТНАЯ ДЛИНА = 537 | 201606)

HSP 1 Оценка: 670,233 бит (1728), ожидаемое значение 0,000e + 0
Идентичность = 331/520 (63,65%), Положительные = 389/520 (74,81%), Фрейм запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARK --------- ARPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLS-SDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL 510
            ME T L + A T + YW ++ RL GP + VWP ++ GSLP LN R + HDWI + NLRA G TYQTC A + PFLA + KQG + TVTC P + N + EHIL + RFDNYPKGP + WQA FHDLLG + GIFNSDG + TWL QRKTAALEFT AEXTLRRLI + RFLQDNGTRTLRQAMARWDDNG T + P LP N F + AFD ATEA + LQR + P + WK + LG EL RSL V NY + E + RK + DDL + SRF + K ++ + LQR + ALNF + LAGRDTSSVALSWFFWL + + P IED I + EI + VL ETRG D LW + EPL + E D + LV + LKAAL + ETLRLYPSVP DKV DDVLPDGTFVP + GS ++ TYSIYS GRMK + WGEDC + EFKP + RW + S SD RF D + KFVAFNAGPR CLGKDLAYLQMKS + ASAVLLR + VL + V GH + V QKMSLTLFM
Sbjct: 1 MEISTALMILSAITA-YFLWLTFISRCLKGPRVWPILGSLPGLIENCERMHDWISDNLRACSG - TYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKNRFDNYPKGPTWQAVFHDLLGQGIFNSDGDTWLFQRKTAALEFTTRTLRQAMARWVNRAIKLRFLPILENARLGSEPIDLQDLLLRLTFDNICGLTFGKDPRTCAPGLPVNTFAVAFDRATEASLQRFILPEILWKFKRWLRLGLEVSLTRSLVQVDNYLSEIITTRKEEMMTQHNNGKHHDDLLSRFIKKKE ---- SYSDETLQRVALNFILAGRDTSSVALSWFFWLITQHPAIEDKILREICTVLVETRGDDVALWTDEPLSCEELDRLVFLKAALSETLRLYPSVPEDSKRAVKDDVLPDGTFVPAGSSITYSIYSAGRMKSTWGEDCLEFKPERWISQSDGGRF-INHDPFKFVAFNAGPRICLGKDLAYLQMKSIASAVLLRHRLTVVTGHKVEQKMSLTLFMKYGLLVNVHERDL 512 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с Araport11
Соответствие: AT1G01600.1 (| цитохром P450% 2C семейство 86% 2C подсемейство A% 2C полипептид 4 | Chr1: 219200-220994 ПЕРЕДНЯЯ ДЛИНА = 554 | 201606)

HSP 1 Оценка: 659,062 бит (1699), ожидание = 0,000e + 0
Идентичность = 323/515 (62,72%), Положительные = 384/515 (74,56%), Кадр запроса = 0

Запрос: 10 LAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKA ----------- RPSDDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDP-KLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLDG 512
            LA + Y WF ++ RL GP + VWP ++ GSLP L R + R + H + WI NLRA GG TYQTC A + PFLA + KQG + TVTC PKN + EH + L + TRFDNYPKGP + WQ + FHDLLG + GIFNSDG + TWL QRKTAALEFTTRTLRQAM RWVNR + PVDLQDL + LRLTFDNICGL FGKD T + P LP + N F + AFD ATEA + LQR + P F + WKL + LG EL RSL + Y + + RK + DDL + SRFM K + + + LQ + ALNF + LAGRDTSVALSWFFWL + + P + ED IV EI SVL E FDE D + LVYLKAA ++ ETLRLYPSVP D K + V NDDVLPDGTFVP + GS + VTYSIY + GRMK + WGEDC + EF P + RW + S + FD Y + FVAFNAGPR CLGKDLAYLQMK ++ A + AVLLR + RL + GLMGHL VFRL + V QF
Sbjct: 9 LVAIVTGYWLWFKRISRWLKGPRVWPLLGSLPGLIEQRDRMHEWITENLRACGG - TYQTCIFAVPFLAKKQGLVTVTCDPKNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIFNSDGDTWLFQRKTAALEFTTRTLRQAMGRWVNRGIKLRFCPILATAQDNAEPVDLQDLILRLTFDNICGLAFGKDTRTCAPGLPENGFASAFDRATEASLQRFIIPKFMWKLKKWLGLGLEVSLSRSLGEIDEYLAAVINTRKQELMSQQESGTHQRHDDLLSRFMMKKT --- ESYSDTFLQHVALNFILAGRDTSSVALSWFFWLITMHPTVEDKIVREICSVLIETRGTDDVASWTEEPLGFDEIDRLVYLKAAISETLRLYPSVPEDSKHVENDDVLPDGTFVPAGSSVTYSIYAAGRMKSTWGEDCLEFNPERWISPIDGKF-INHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKVEQKMSLTLFMKNGLLVNLYKRDLQG 517 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с Araport11
Соответствие: AT5G08250.2 (| белок суперсемейства Cytochrome P450 | Chr5: 2653766-2655781 ОБРАТНАЯ ДЛИНА = 550 | 201606)

HSP 1 Оценка : 453,366 бит (1165), Expect = 7,971e-155
Идентичность = 241/524 (45,99%), положительные результаты = 332/524 (63,36%), кадр запроса = 0

Запрос: 1 METLTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTN-RNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPS -------- DDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGR-DPKLWVEEPLVF - DEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRY - RLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL 510
            + E FF ASL + KG VWP + VG LP L + R + I ++ W ++ L + G + ++ P + + + VTC P + N + EH + L + TRF YPKG ++ DLLG + GIFN + D TW QRK A ++ EF + RQ ++ ++ + NRL + L + + K + DLQD + LLRLTFDN + C + FG DP LSP LP + PF + KAF ++ ATEAT + R + P FVWKL + + LG EK + LK S + V ++ + E + RK S DL ++ FM RD + GF L + I + NF + LAGRDTSSVALSWFFWL + NPE + E + I + I + L + DK + E VF + E K + YL + AAL + ETLRLYPSVP + DK V + DDV PDGT + GV Y + IY ++ GRM + TIWG + DC EFKP + RWL RE + YKF AFN GPR CLGKD AY QM + VA + A ++ RY R + GH + V KM + LT ++ MK + GLKV R +
Sbjct: 40 LELFIAFFVFATIHS ------- ----- LRQKKHQGMPVWPLVGMLPSLISAVRSNIYEWLSDVLISQNGTFRFRG PWFSTLNCV - VTCDPRNVEHLLKTRFSIYPKGSYFRETMQDLLGDGIFNTDDGTWQRQRKAASVEFHSAKFRQLTSQSLHELVHNRLLPVLETSGK ---- IDLQDILLRLTFDNVCMIAFGVDPGCLSPKLPEIPFAKAFEDATEATVVRFVMPKFVWKLMRSLNLGTEKKLKESINGVDDFAEEVIRTRKKEMSLETEIAKRPDLLTIFMGLRDENGQKFSDKFLRDICVNFILAGRDTSSVALSWFFWLIEKNPEVEEKIMMGICKILEQRVDHGDTKKNMEYEPVFRPEEIKKMDYLQAALSETLRLYPSVPVDHKEVLEDDVFPDGTKLKKGEKVIYAIYAMGRMETIWGKDCREFKPERWLRDGRYMSE --- SAYKFTAFNGGPRLCLGKDFAYYQMRYVAAAIIYRYKVRVDDKGGHKVEPKMALTMYMKHGLKVNMVKRSV 542 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с Araport11
Соответствие: AT5G08250.1 (| белок суперсемейства Cytochrome P450 | Chr5: 2653766-2655595 ОБРАТНАЯ ДЛИНА = 488 | 201606)

HSP 1 Оценка : 446,432 бит (1147), Expect = 5,090e-153
Identity = 233/492 (47,36%), положительные результаты = 322/492 (65,45%), кадр запроса = 0

Запрос: 33 VWPVVGSLPVLFTN-RNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPS -------- DDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGR-DPKLWVEEPLVF - DEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRY - RLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKL 510
            VWP + VG LP L + R + I ++ W ++ L + G + ++ P + + + VTC P + N + EH + L + TRF YPKG ++ DLLG + GIFN + D TW QRK A ++ EF + RQ ++ ++ + NRL + L + + K + DLQD + LLRLTFDN + C + FG DP LSP LP + PF + KAF ++ ATEAT + R + P FVWKL + + LG EK + LK S + V ++ + E + RK S DL ++ FM RD + GF L + I + NF + LAGRDTSSVALSWFFWL + NPE + E + I + I + L + DK + E VF + E K + YL + AAL + ETLRLYPSVP + DK V + DDV PDGT + GV Y + IY ++ GRM + TIWG + DC EFKP + RWL A RE + YKF AFN GPR CLGK VA + A ++ RY R + GH + V KM + LT ++ MK + GLKV R +
Sbjct: 3 VWPLVGMLPSLISAVRSNIYEWLSDVLISQNGTFRFRG ----- PWFSTLNCV - VTCDPRNVEHLLKTRFSIYPKGSYFRETMQDLLGDGIFNTDDGTWQRQRKAASVEFHSAKFRQLTSQSLHELVHNRLLPVLETSGK ---- IDLQDILLRLTFDNVCMIAFGVDPGCLSPKLPEIPFAKAFEDATEATVVRFVMPKFVWKLMRSLNLGTEKKLKESINGVDDFAEEVIRTRKKEMSLETEIAKRPDLLTIFMGLRDENGQKFSDKFLRDICVNFILAGRDTSSVALSWFFWLIEKNPEVEEKIMMGICKILEQRVDHGDTKKNMEYEPVFRPEEIKKMDYLQAALSETLRLYPSVPVDHKEVLEDDVFPDGTKLKKGEKVIYAIYAMGRMETIWGKDCREFKPERWLRDGRYMSE --- SAYKFTAFNGGPRLCLGKDFAYYQMRYVAAAIIYRYKVRVDDKGGHKVEPKMALTMYMKHGLKVNMVKRSV 480 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с Araport11
Соответствие: AT5G23190.1 (| цитохром P450% 2C семейство 86% 2C подсемейство B% 2C полипептид 1 | Chr5: 7803478-7805659 ОБРАТНАЯ ДЛИНА = 559 | 201606)

HSP 1 Оценка: 445.277 бит (1144), ожидаемое значение 1.782e-151
Идентичность = 229/505 (45,35%), Положительные = 315/505 (62,38%), Фрейм запроса = 0

Запрос: 10 LAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVL-FTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPS -------- DDLISRFMNKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSE - TRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKV 503
            LA V + L + KG VWP + G LP LFR I ++ W ++ L G + ++ P + + T + TC P + N + EH + L + RF + PKG ++ DLLG + GIFN + D ETW QRKTA ++ EF + RQ + + + RL + L + + K + P + DLQD + LLRLTFDN + C + FG DP L PD P PF + KAF ++ ATEA + R + P + VWK D + G EK + LK S + V ++ DE + RK S DL ++ FM RD GF L + I + NF + LAGRDTSSVALSWFFWL + NPE + E + I + E + + L + GKE + E K + YL + AAL + E LRLYPSVP + DKV DDV PDGT + GV Y + IY ++ GRM + IWG + DC + EF + P + RWL RE + YKF AFN GPR CLGKD QMKS A + A ++ RY ++ V GH + V K ++ LT ++ MK + GL V
Sbjct: 41 LLIAIFVFVAIHALRQKKYQGLPVWPFLGMLPSLAFGLRGNIYEWLSDVLCLQNGTFQFRG ----- PWFSSLNS - TITCDPRNVEHLLKNRFSVFPKGSYFRDNLRDLLGDGIFNADDETWQRQRKTASIEFHSAKFRQLTTQSLFELVHKRLLPVLETSVKSSSPIDLQDVLLRLTFDNVCMIAFGVDPGCLGPDQPVIPFAKAFEDATEAAVVRFVMPTCVWKFMRYLDIGTEKKLKESIKGVDDFADEVIRTRKKELSLEGETTKRSDLLTVFMGLRDEKGESFSDKFLRDICVNFILAGRDTSSVALSWFFWLLEKNPEVEEKIMVEMCKILRQRDDHGNAEKSDYEPVFGPEEIKKMDYLQAALSEALRLYPSVPVDHKEVQEDDVFPDGTMLKKGDKVIYAIYAMGRMEAIWGKDCLEFRPERWLRDGRFMSE --- SAYKFTAFNGGPRLCLGKDFAYYQMKSTAAAIVYRYKVKVVNGHKVEPKLALTMYMKHGLMV 535 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с Araport11
Соответствие: AT1G13150.1 (| цитохром P450% семейство 2C 86% 2C подсемейство C% 2C полипептид 4 | Chr1: 4481995-4483584 ОБРАТНАЯ ДЛИНА = 529 | 201606)

HSP 1 Оценка: 403,675 бит (1036), ожидаемое = 1.115e-135
Identity = 208/514 (40,47%), Postives = 309/514 (60,12%), Query Frame = 0

Запрос: 21 FYLLARKLT --- GPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSD -------- DLISRFM ---- NKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLDGPGLVATS 519
            FL KLT GP + WPV GF + N ++ W + + L + G + Y + + + A VTC P N + E ++ L + TF N + PKG +++ F + DLL EGIFN + D ++ W QR + E + + + + R + L +++ + K DLQD + LRLTFD IC G DPETL + DLP PF + KAF + ATE + TL R + P F + WK DG EK L + ++ VV ++ D + + R + D ++ SR + + KR + + + P ++ + F + LAGRDTSSVALSWF W ++ + PE + E + I + EI + L + RG PEE + + VYL + AAL + ETLRL + P + P ++ K + DDVLPDGTFV GS V + SIY ++ GRM ++ IWG + DC F + P + RW + + + D + K + V FNAGPR C + GK AYLQMK + A ++ VLLRY + VH + +++ L + MKYGLKV PR L + L + S
Sbjct: 26 FCCLREKLTNKRGPMLWPVFGITLEFFFHINDVYGWVTRSLKKCRGTFLYRGVWLDGSYGA ------- VTCVPANVEYMLKTNFKNFPKGTFFKSRFNDLLEEGIFNADDDSWKEQRRIIITEMHSTGFVEHSFQTTQHLVRKKLLKVMESFAKSQEAFDLQDVFLRLTFDIICLAGLGADPETLAVDLPQVPFAKAFEEATESTLFRFMIPPFIWKPMRFLDTGYEKGLRIAVGVVHGFVDKMIVDRICELKEEETLDNRSDVLSRIIQIESHKRENEIDPSTIRFFRQFCTSFILAGRDTSSVALSWFCWVIQKHPEVENKIICEIREILRQ-RGDSPTSKNESLFTVKELNNMVYLQAALSETLRLFPPIPMEMKQAIEDDVLPDGTFVRKGSRVYFSIYAMGRMESIWGKDCEIFRPERWIQAGKF --- VSDDQFKYVVFNAGPRLCIGKTFAYLQMKMIAASVLLRYSIKVVQDHVIAPRVTTNLYMKYGLKVTITPRSLEEKKLESCS 528 
ВЗРЫВ ЭВМ. model.ctg8.22 в сравнении с Araport11
Соответствие: AT1G13140.1 (| цитохром P450% семейство 2C 86% 2C подсемейство C% 2C полипептид 3 | Chr1: 4478667-4480271 ОБРАТНАЯ ДЛИНА = 534 | 201606)

HSP 1 Оценка: 402,905 бит (1034), ожидаемое значение 3.274e-135
Identity = 202/508 (39,76%), Postives = 307/508 (60,43%), Query Frame = 0

Запрос: 16 VYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGGSSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIFNSDGETWLIQRKTAALEFTTRTLRQAMARWVNRTIRNRLWCILDKASKDHTPVDLQDLLLRLTFDNICGLTFGKDPETLSPDLPDNPFSKAFDNATEATLQRLLYPSFVWKLQNAFDLGAEKQLKRSLAVVGNYMDEAVAARKARPSD -------- DLISRFM ---- NKRDVDGNPFPSSVLQRIALNFVLAGRDTSSVALSWFFWLVMNNPEIEDNIVNEITSVLSETRGRDPKLWVEEPLVFDEADKLVYLKAALAETLRLYPSVPLDFKYVVNDDVLPDGTFVPSGSTVTYSIYSVGRMKTIWGEDCMEFKPDRWLSSDRTRFEPPKDSYKFVAFNAGPRTCLGKDLAYLQMKSVASAVLLRYRLSPVPGHRVVQKMSLTLFMKYGLKVYFQPRKLD 511
            V + C + + KL GP + WPV GPF + RN ++ W L + G + Y + + A VTC P N + E ++ L + TF N + PKG ++ F + DLL + GIFN + D E + W QR + E + + + + R + L +++ ++ DLQD + LLRLTFDNIC G DP TL DLP PF ++ AF + ATE + T + R + P F + WK FD + G EK L ++++ VV ++ D + VR + + D ++ SR + + K + + P ++ + F + LAGRDTSSVAL + WFFW ++ + PE + E + I + EI + + L + RG PEE + + VYL + AAL + ET + RLYP + P ++ K + DDV PDGTF + GS V ++ Y ++ GRM ++ IWG + DC FKP + RW + SD + K + V FNAGPR CLGK AYLQMK ++ A ++ VL RY + H VV +++ TL + M ++ GLKV + L +
Sbjct: 32 VFCCVREKVTKKL-GPTIWPVFGITPEFFFHRNDVYGWATRCLKKCRGTFLYNGIWLGGSYGA ------- VTCVPANVEYMLKTNFKNFPKGAFFKERFNDLLEDGIFNADAESWKEQRRIIITEMHSTRFVEHSFQTTQDLVRKKLLKVMESFARSQEAFDLQDVLLRLTFDNICIAGLGDDPGTLDSDLPLVPFAQAFEEATESTMFRFMIPPFIWKPLKFFDIGYEKGLRKAVDVVHEFVDKMVVDRICKLKEEGTLGNRSDVLSRIIEIESHKTTDEKDPSTIKFFRQFCTSFILAGRDTSSVALTWFFWVIQKHPEVENKIIREISEILRQ-RGDSPTSKNESLFTVKELNDMVYLQAALSETMRLYPPIPMEMKQAIEDDVFPDGTFIRKGSRVYFATYAMGRMESIWGKDCESFKPERWIQSGNF --- VNDDQFKYVVFNAGPRLCLGKTFAYLQMKTIAASVLSRYSIKVAKDHVVVPRVTTTLYMRHGLKVTISSKSLE 527 

Для этой функции доступны следующие результаты BLAST:

Применение силовых кабелей ВВГ и ним

Кабель ВВГ

Широкое распространение ВВГ обусловлено высокими характеристиками, безопасностью и надежностью, а также невысокой ценой. Кабель ВВГ способен выдерживать как палящий мороз, так и ту же жару, может эксплуатироваться в условиях повышенной влажности, имеет огнестойкие и дымовые свойства, не поддерживает горение.

Используется для передачи и распределения электроэнергии в сетях напряжением 0,66 и 1 кВ и частотой 50 Гц. То есть спектр применения достаточно широк и для электростанций, и для жилых или производственных помещений, почти наверняка по качеству проводки в вашей квартире с использованием этого кабеля. Благодаря самозатухающей оболочке из ПВХ можно использовать в помещениях с повышенными требованиями пожарной безопасности.

Проволока ВВГ имеет 1-5 медных жил круглого или кругового сечения. Они могут быть одинакового размера или с более тонким проводом заземления или нулевой фазой. И отдельные провода, и кабель имеют оболочку из ПВХ. Земля обычно обозначается желто-зеленым цветом, а нулевая фаза имеет синий или синий цвет.

Оболочка устойчива к солнечному свету, что означает, что она подходит для уличного (открытого) складирования без каких-либо ограничений. Обратите внимание, Вас также могут заинтересовать кабельные каналы ДКС оптом и другое профоборудование и аксессуары, ссылка есть на сайте ДКС.Москва.

Кабель NYM

Кабель Nym аналогичен кабелю ВВГ и также широко применяется для ленточных осветительных и силовых цепей напряжением до 660В и частотой 50 Гц. В отличие от ВВГ кабель NYM имеет закругленный наполнитель из невулканизированной резины, который объединяет пряди, и поэтому может использоваться в местах, где есть сжатие кабеля.

Хотя резина и подвержена горению, кабель пожароопасен, так как распространению огня препятствует ПВХ, который быстро тускнеет.Кабель не подходит для прокладки в земле и использования солнечного света на открытом пространстве, так как под воздействием ультрафиолета его внешняя оболочка разрушается.

NYM имеет от одного до пяти медных проводов с ПВХ изоляцией разных цветов, что упрощает монтаж схемы. Жилы в поперечном сечении закругленные. Если кабель одножильный, дополнительная резиновая изоляция отсутствует.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *